DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PVRAP and TNS2

DIOPT Version :10

Sequence 1:NP_729124.1 Gene:PVRAP / 38677 FlyBaseID:FBgn0052406 Length:474 Species:Drosophila melanogaster
Sequence 2:NP_001403133.1 Gene:TNS2 / 23371 HGNCID:19737 Length:1418 Species:Homo sapiens


Alignment Length:128 Identity:49/128 - (38%)
Similarity:68/128 - (53%) Gaps:27/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 WYQAGISRDIAVEVLQSKSPGAFLVRKSSSKPGCYALTLRVPSPPGPK------------IANYI 394
            ||:..:|||.|:.:|:.|.|||||:|.|.|..|.|.|.|:|.:|| |.            :.:::
Human  1149 WYKPHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPP-PSAQPWKGDPVEQLVRHFL 1212

  Fly   395 ILRSPRGYKIKGFRKE--FSSLKALITHHSVMPELLPVPLAMPR------------PTNMSSS 443
            |...|:|.||||...|  |.||.||::.||:.|..||..|.:|.            |||||::
Human  1213 IETGPKGVKIKGCPSEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAPVPTNMSTA 1275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PVRAPNP_729124.1 SH2 342..435 CDD:472789 43/106 (41%)
TNS2NP_001403133.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
C1_TNS2 30..83 CDD:410437
PTP_tensin-2 132..290 CDD:350410
PTEN_C2 297..424 CDD:463081
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 571..591
PHA03247 <780..1137 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 821..1107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1120..1139
SH2_Tensin_like 1145..1258 CDD:198181 44/109 (40%)
PTB_tensin 1282..1414 CDD:269924
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.