DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and SPAG6

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_036575.1 Gene:SPAG6 / 9576 HGNCID:11215 Length:509 Species:Homo sapiens


Alignment Length:414 Identity:88/414 - (21%)
Similarity:164/414 - (39%) Gaps:69/414 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KIRADAADALAHIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDY 142
            |.|......:|.:|: ..::...:..||.:..|..||....|.:.:...|:||.|.::..:|.:.
Human    15 KARTQFVQMVAELAT-RPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEA 78

  Fly   143 IIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAAEII-----QALNIVLYNP 202
            :::..::.:|:..:.:::  ........:|||.:...|    |..|..|:     ..|.|.|.:.
Human    79 VVKCDILPQLVYSLAEQN--RFYKKAAAFVLRAVGKHS----PQLAQAIVDCGALDTLVICLEDF 137

  Fly   203 EANVLEDALMAVRNLA-HGNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQI 266
            :..|.|.|..|:|.:| |..|..|.::|...||.::..::.|.:.::..|..||.:||..|.|..
Human   138 DPGVKEAAAWALRYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDIAKHSPELA 202

  Fly   267 QELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISL 331
            |.:::...:.||:.::.|.|..::.|:|..|..::..::.....::.|.:...:|.|||.....:
Human   203 QTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEAEIFPVVLTCLKDKDEYV 267

  Fly   332 KSAAALTITTLA-------------------ID-----KDKNLLCYLMRQGVIPEFC-NLLFCQE 371
            |..|:..|..:|                   ||     |....|..:|..|.:.... ||.... 
Human   268 KKNASTLIREIAKHTPELSQLVVNAGGVAAVIDCIGSCKGNTRLPGIMMLGYVAAHSENLAMAV- 331

  Fly   372 RDILSNVLDILSTMLDVDPSFSAEVSGIIEWS---------------GALNNIRMLQS-----SE 416
              |:|..:..||..|..:|  ...:.....|:               ...|.:.:|.|     ..
Human   332 --IISKGVPQLSVCLSEEP--EDHIKAAAAWALGQIGRHTPEHARAVAVTNTLPVLLSLYMSTES 392

  Fly   417 HEEIAAVARKIIGN------YFPA 434
            .|::...::|.|.|      |.||
Human   393 SEDLQVKSKKAIKNILQKCTYLPA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 19/98 (19%)
armadillo repeat 98..134 CDD:293788 10/35 (29%)
armadillo repeat 140..176 CDD:293788 4/35 (11%)
ARM 189..301 CDD:237987 32/117 (27%)
armadillo repeat 192..217 CDD:293788 8/29 (28%)
armadillo repeat 224..260 CDD:293788 9/35 (26%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 28/133 (21%)
armadillo repeat 308..342 CDD:293788 8/33 (24%)
armadillo repeat 350..383 CDD:293788 7/33 (21%)
Arm_3 400..>433 CDD:292804 9/58 (16%)
SPAG6NP_036575.1 ARM 1 31..70 10/38 (26%)
armadillo repeat 37..68 CDD:293788 9/30 (30%)
ARM 2 73..112 5/40 (13%)
armadillo repeat 78..110 CDD:293788 4/33 (12%)
SRP1 112..>423 CDD:227396 69/314 (22%)
ARM 3 115..154 11/38 (29%)
armadillo repeat 120..152 CDD:293788 9/31 (29%)
ARM 4 157..196 10/38 (26%)
armadillo repeat 160..196 CDD:293788 9/35 (26%)
ARM 5 199..238 9/38 (24%)
armadillo repeat 202..234 CDD:293788 7/31 (23%)
ARM 6 241..280 8/38 (21%)
armadillo repeat 244..278 CDD:293788 8/33 (24%)
HEAT repeat 289..325 CDD:293787 6/35 (17%)
ARM 7 325..365 9/44 (20%)
HEAT repeat 335..369 CDD:293787 5/35 (14%)
ARM 8 368..409 7/40 (18%)
HEAT repeat 378..406 CDD:293787 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.