DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and AT1G32880

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_174565.1 Gene:AT1G32880 / 840182 AraportID:AT1G32880 Length:183 Species:Arabidopsis thaliana


Alignment Length:193 Identity:44/193 - (22%)
Similarity:79/193 - (40%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 VQNAALQALIN-IATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADGNIFQRHA 310
            :::.|:..||. :...|..::|.:::.||:|.|..|..|::.|::                    
plant    21 IRSGAVHRLIQFLLDESFPKLQSVIDANLIPTLVKLTQNAEFDMK-------------------- 65

  Fly   311 IMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNLLFCQERDIL 375
                                .:|..|::..||....|:  :.|::.|..|...|::|||.:...:
plant    66 --------------------KESVCAISNATLLGSHDQ--IKYMVEQSCIKPLCDILFCPDVKTI 108

  Fly   376 SNVLDILSTMLDV---DPSFSAEVS---GIIEWSGALNNIRMLQSSEHEEIAAVARKIIGNYF 432
            ...||.:...|.|   :.:...:||   .:||..| |:.|..||..|:.||...|.||:..|:
plant   109 LKCLDGMENTLKVGEAEKNAGDDVSWYTRLIEAEG-LDKILNLQRHENIEIYDKALKILQTYW 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987
armadillo repeat 98..134 CDD:293788
armadillo repeat 140..176 CDD:293788
ARM 189..301 CDD:237987 12/54 (22%)
armadillo repeat 192..217 CDD:293788
armadillo repeat 224..260 CDD:293788 3/13 (23%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 19/108 (18%)
armadillo repeat 308..342 CDD:293788 2/33 (6%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 14/33 (42%)
AT1G32880NP_174565.1 armadillo repeat 41..78 CDD:293788 11/76 (14%)
ARM 44..166 CDD:237987 37/164 (23%)
armadillo repeat 84..117 CDD:293788 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.