DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and IMPA-6

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_973743.1 Gene:IMPA-6 / 839517 AraportID:AT1G02690 Length:539 Species:Arabidopsis thaliana


Alignment Length:465 Identity:134/465 - (28%)
Similarity:236/465 - (50%) Gaps:39/465 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKRKRRFL------KKGQNL--MMLRTLRLEK---------AKKAELQKELTIYNALTKCKLTS 48
            :||::|...      :.||:.  .:....|||.         ::..:||.|.|    .:..:|.|
plant    45 LQKKRREGFNPSMASQPGQDFSSSLPTETRLENIQQMIAGVMSEDRDLQLEAT----ASFRRLLS 105

  Fly    49 SEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVPRLIRL 113
            .|..|.:|::::|..:.::|:.|...:..:::.:||.||.:||||:||::.:|..:||||..::|
plant   106 IERNPPINEVVQSGVVPHIVQFLSRDDFTQLQFEAAWALTNIASGTSENTRVIIDSGAVPLFVKL 170

  Fly   114 LQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRKLCI 178
            |.|...||.|:.:.:|||:...:|..||:::....|..|::...:.|..: ||.:.||.|...|.
plant   171 LSSASEEVREQAVWALGNVAGDSPKCRDHVLSCEAMMSLLAQFHEHSKLS-MLRNATWTLSNFCR 234

  Fly   179 SS-QPSPPDNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPRIIYLLE 241
            .. ||:........:.||..:|::.:..||.||..|:..|:.| ||.||.::|..|:||::.||.
plant   235 GKPQPAFEQQTKAALPALERLLHSTDEEVLTDASWALSYLSDGTNEKIQTVIDAGVIPRLVQLLA 299

  Fly   242 HPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNS-DPDIRCQVLKLLLNIADGNI 305
            ||:.:|...||:.:.||.||.:.|.|.::::..||.|..|:.|: ...|:.:....:.||..||.
plant   300 HPSPSVLIPALRTIGNIVTGDDIQTQAVISSQALPGLLNLLKNTYKKSIKKEACWTISNITAGNT 364

  Fly   306 FQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNLLFCQ 370
            .|...:..||::..::..|:.....:|..|...|:......:.:.:.:|:.||.|...|:||.|.
plant   365 SQIQEVFQAGIIRPLINLLEIGEFEIKKEAVWAISNATSGGNHDQIKFLVSQGCIRPLCDLLPCP 429

  Fly   371 ERDILSNVLDILSTMLDVDPSFSAE-----------VSGIIEWSGALNNIRMLQSSEHEEIAAVA 424
            :..:::..|:.|..:|.|.   .||           .:.:||.:..|:.|..|||.::.||...|
plant   430 DPRVVTVTLEGLENILKVG---EAEKNLGNTGNDNLYAQMIEDADGLDKIENLQSHDNNEIYEKA 491

  Fly   425 RKIIGNYFPA 434
            .||:.:|:.|
plant   492 VKILESYWAA 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 38/119 (32%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 10/35 (29%)
ARM 189..301 CDD:237987 38/113 (34%)
armadillo repeat 192..217 CDD:293788 8/24 (33%)
armadillo repeat 224..260 CDD:293788 15/35 (43%)
armadillo repeat 266..300 CDD:293788 7/34 (21%)
ARM 276..385 CDD:237987 26/109 (24%)
armadillo repeat 308..342 CDD:293788 6/33 (18%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 13/32 (41%)
IMPA-6NP_973743.1 ARM 248..361 CDD:237987 39/112 (35%)
armadillo repeat 249..274 CDD:293788 8/24 (33%)
armadillo repeat 282..318 CDD:293788 15/35 (43%)
armadillo repeat 324..359 CDD:293788 7/34 (21%)
armadillo repeat 367..403 CDD:293788 6/35 (17%)
ARM 368..500 CDD:237987 33/134 (25%)
armadillo repeat 410..444 CDD:293788 10/33 (30%)
IBB 8..97 CDD:280005 11/51 (22%)
SRP1 10..537 CDD:227396 134/465 (29%)
armadillo repeat 78..103 CDD:293788 4/28 (14%)
ARM 114..234 CDD:237987 38/120 (32%)
armadillo repeat 115..147 CDD:293788 7/31 (23%)
armadillo repeat 155..191 CDD:293788 14/35 (40%)
armadillo repeat 197..231 CDD:293788 10/34 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.