DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and IMPA-4

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_172398.1 Gene:IMPA-4 / 837448 AraportID:AT1G09270 Length:538 Species:Arabidopsis thaliana


Alignment Length:463 Identity:139/463 - (30%)
Similarity:239/463 - (51%) Gaps:34/463 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRKRRFLKKGQNLMML-RTLRLEKA-----KKAELQKELT--------IYN--------ALTKC- 44
            ||:...|||.:..||| :.|.|...     ..|.::|.|.        :|:        |.|:. 
plant    40 KREDSLLKKRREGMMLQQQLPLGAGLDGPQTAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFR 104

  Fly    45 KLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVPR 109
            ||.|.|..|.:::::|:..|...||.||..:..:::.:||.||.::|||:|:|:.::.:.||||.
plant   105 KLLSIERSPPIDEVIKAGVIPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPI 169

  Fly   110 LIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLR 174
            .::||.|...:|.|:.:.:|||:...:||.|:.::.:|.::.|::.:.:.|..: ||.:.||.|.
plant   170 FVKLLTSASDDVREQAVWALGNVAGDSPNCRNLVLNYGALEPLLAQLNENSKLS-MLRNATWTLS 233

  Fly   175 KLCISSQPSPPDNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPRIIY 238
            ..|....|:|.:.....:..|..::|..:..||.||..|:..|:.| |:.||.:::..|.||::.
plant   234 NFCRGKPPTPFEQVKPALPILRQLIYLNDEEVLTDACWALSYLSDGPNDKIQAVIEAGVCPRLVE 298

  Fly   239 LLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHL-SALMSNSDPDIRCQVLKLLLNIAD 302
            ||.|.:.||...||:.:.||.||.:.|.|.::.:.:|||| :.|..|....|:.:....:.||..
plant   299 LLGHQSPTVLIPALRTVGNIVTGDDSQTQFIIESGVLPHLYNLLTQNHKKSIKKEACWTISNITA 363

  Fly   303 GNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNLL 367
            ||..|..|::.||::..::..|:.....:|..||..|:..........:.||:.||.|...|:||
plant   364 GNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLL 428

  Fly   368 FCQERDILSNVLDILSTML-----DVDPSFSAEV---SGIIEWSGALNNIRMLQSSEHEEIAAVA 424
            .|.:..|::..|:.|..:|     |.:...::.|   :.|||.|..|:.:..|||.::.||...|
plant   429 ICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKA 493

  Fly   425 RKIIGNYF 432
            .||:..|:
plant   494 VKILERYW 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 38/119 (32%)
armadillo repeat 98..134 CDD:293788 12/35 (34%)
armadillo repeat 140..176 CDD:293788 9/35 (26%)
ARM 189..301 CDD:237987 36/113 (32%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 8/34 (24%)
ARM 276..385 CDD:237987 31/109 (28%)
armadillo repeat 308..342 CDD:293788 8/33 (24%)
armadillo repeat 350..383 CDD:293788 11/32 (34%)
Arm_3 400..>433 CDD:292804 13/33 (39%)
IMPA-4NP_172398.1 SRP1 17..536 CDD:227396 139/463 (30%)
armadillo repeat 81..106 CDD:293788 3/24 (13%)
armadillo repeat 118..150 CDD:293788 10/31 (32%)
armadillo repeat 158..194 CDD:293788 12/35 (34%)
armadillo repeat 200..234 CDD:293788 9/34 (26%)
armadillo repeat 251..276 CDD:293788 7/24 (29%)
armadillo repeat 284..320 CDD:293788 14/35 (40%)
armadillo repeat 326..361 CDD:293788 8/34 (24%)
armadillo repeat 369..405 CDD:293788 8/35 (23%)
armadillo repeat 412..446 CDD:293788 12/33 (36%)
armadillo repeat 466..500 CDD:293788 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.