DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and IMPA-8

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_200013.1 Gene:IMPA-8 / 835275 AraportID:AT5G52000 Length:441 Species:Arabidopsis thaliana


Alignment Length:408 Identity:109/408 - (26%)
Similarity:214/408 - (52%) Gaps:30/408 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ALTKCKLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKA 104
            ::||.:..:|:  .|::.:::|..:..||:.|.:....|::.:.|.||.:||   .::..::...
plant    29 SVTKIRRITSQ--RDISCVIRSGVVPRLVQLLKNQVFPKLQYEVAWALTNIA---VDNPGVVVNN 88

  Fly   105 GAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHV 169
            .|||.||:|:.||...|.|:.|.:|.|:...:.:.||:::..|::..|:.::...:|    |...
plant    89 NAVPVLIQLIASPKDYVREQAIWTLSNVAGHSIHYRDFVLNSGVLMPLLRLLYKDTT----LRIA 149

  Fly   170 TWVLRKLCISSQPSPP-DNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHGNET-IQMLLDFEV 232
            ||.||.|| ..:|.|. |.....:.||.|:|::.:.:||::|.||:.:|:.|:|. ||.:::...
plant   150 TWALRNLC-RGKPHPAFDQVKPALPALEILLHSHDEDVLKNACMALCHLSEGSEDGIQSVIEAGF 213

  Fly   233 VPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMS-NSDPDIRCQVLKL 296
            ||:::.:|:.|:..|...||..:..:..|:.:|.|.::|:..||.:|.::: |.:..|:.....:
plant   214 VPKLVQILQLPSPVVLVPALLTIGAMTAGNHQQTQCVINSGALPIISNMLTRNHENKIKKCACWV 278

  Fly   297 LLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIP 361
            :.||..|...|..::::|.|:..::...:.....:|..|...|:.:|::...:.:.|:..|..|.
plant   279 ISNITAGTKEQIQSVIDANLIPILVNLAQDTDFYMKKEAVWAISNMALNGSHDQIKYMAEQSCIK 343

  Fly   362 EFCNLL-FCQERDILSNVLDILSTML----------DVDPSFSAEVSGIIEWSGALNNIRMLQSS 415
            :.|::| :..||..:...||.|..||          ||:|     ...:||.:..|..|..||.:
plant   344 QLCDILVYSDERTTILKCLDGLENMLKAGEAEKNSEDVNP-----YCLLIEDAEGLEKISKLQMN 403

  Fly   416 EHEEIAAVARKI-IGNYF 432
            ::::|...|.|| :.|:|
plant   404 KNDDIYEKAYKILVTNWF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 33/119 (28%)
armadillo repeat 98..134 CDD:293788 13/35 (37%)
armadillo repeat 140..176 CDD:293788 10/35 (29%)
ARM 189..301 CDD:237987 31/113 (27%)
armadillo repeat 192..217 CDD:293788 9/24 (38%)
armadillo repeat 224..260 CDD:293788 9/35 (26%)
armadillo repeat 266..300 CDD:293788 7/34 (21%)
ARM 276..385 CDD:237987 24/110 (22%)
armadillo repeat 308..342 CDD:293788 5/33 (15%)
armadillo repeat 350..383 CDD:293788 9/33 (27%)
Arm_3 400..>433 CDD:292804 12/34 (35%)
IMPA-8NP_200013.1 HEAT repeat 14..39 CDD:293787 2/9 (22%)
armadillo repeat 44..77 CDD:293788 8/32 (25%)
ARM 45..158 CDD:237987 35/120 (29%)
HEAT_2 51..156 CDD:290374 32/111 (29%)
armadillo repeat 85..118 CDD:293788 13/32 (41%)
armadillo repeat 124..156 CDD:293788 10/35 (29%)
ARM 171..284 CDD:237987 32/112 (29%)
armadillo repeat 172..197 CDD:293788 9/24 (38%)
armadillo repeat 205..241 CDD:293788 9/35 (26%)
armadillo repeat 247..282 CDD:293788 7/34 (21%)
ARM 250..368 CDD:237987 26/117 (22%)
armadillo repeat 290..324 CDD:293788 5/33 (15%)
armadillo repeat 333..368 CDD:293788 10/34 (29%)
Arm_3 382..>421 CDD:292804 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.