DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and IMPA-5

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_199742.1 Gene:IMPA-5 / 834991 AraportID:AT5G49310 Length:519 Species:Arabidopsis thaliana


Alignment Length:471 Identity:135/471 - (28%)
Similarity:230/471 - (48%) Gaps:49/471 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QKRKRRFL------KKGQNLMMLRTLR-----------------LEKAK--------KAELQKEL 35
            ::|:..||      |:.:|||..|.::                 ||.|.        ...||.|.
plant    26 RRRREDFLVEIRKSKRNENLMKKRRVKVLPPDYKLISNDPFESLLEIANMITGVFSDDPSLQLEY 90

  Fly    36 TIYNALTKCKLT-SSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSN 99
            |     |:.::. |.:..|..:.::||..:...||.|...:..|::.:||.||.:||||:|||:.
plant    91 T-----TRFRVVLSFDRSPPTDNVIKSGVVPRFVEFLKKDDNPKLQFEAAWALTNIASGASEHTK 150

  Fly   100 LIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTL 164
            ::...|.||..::||.|||.:|.|:.|..|||:...:...||:::..|....|:..:.:.:|.::
plant   151 VVIDHGVVPLFVQLLASPDDDVREQAIWGLGNVAGDSIQCRDFVLNSGAFIPLLHQLNNHATLSI 215

  Fly   165 MLSHVTWVLRKLCISSQPSPP-DNAAEIIQALNIVLYNPEANVLEDALMAVRNLAH-GNETIQML 227
             |.:.||.|... ...:|||| |....::..|..::|:.:..||.||..|:.||:. .||.||.:
plant   216 -LRNATWTLSNF-FRGKPSPPFDLVKHVLPVLKRLVYSDDEQVLIDACWALSNLSDASNENIQSV 278

  Fly   228 LDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMS-NSDPDIRC 291
            ::..||||::.||:|.:..|...||:.:.||.:|:.:|...::|..:||.|:.|:: |....||.
plant   279 IEAGVVPRLVELLQHASPVVLVPALRCIGNIVSGNSQQTHCVINCGVLPVLADLLTQNHMRGIRR 343

  Fly   292 QVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMR 356
            :....:.||..|...|..::::|.|:..::...:.....:|..|...|:..::....|.:.||:.
plant   344 EACWTISNITAGLEEQIQSVIDANLIPSLVNLAQHAEFDIKKEAIWAISNASVGGSPNQIKYLVE 408

  Fly   357 QGVIPEFCNLLFCQERDILSNVLDILSTML---DVDPSFSAEV---SGIIEWSGALNNIRMLQSS 415
            |..|...|::|.|.:..|:...|..|..:|   :||.:. .:|   |.:||.:..|..|..||..
plant   409 QNCIKALCDILVCPDLRIILVSLGGLEMILIAGEVDKNL-RDVNCYSQMIEDAEGLEKIENLQHH 472

  Fly   416 EHEEIAAVARKIIGNY 431
            .:.||...|.||:..|
plant   473 GNNEIYEKAVKILQTY 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 40/119 (34%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 9/35 (26%)
ARM 189..301 CDD:237987 36/113 (32%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 8/34 (24%)
ARM 276..385 CDD:237987 26/109 (24%)
armadillo repeat 308..342 CDD:293788 5/33 (15%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 12/32 (38%)
IMPA-5NP_199742.1 IBB 8..92 CDD:280005 15/70 (21%)
SRP1 10..517 CDD:227396 135/471 (29%)
ARM 107..228 CDD:237987 40/122 (33%)
armadillo repeat 109..141 CDD:293788 10/31 (32%)
armadillo repeat 149..185 CDD:293788 14/35 (40%)
armadillo repeat 191..225 CDD:293788 9/34 (26%)
ARM 241..354 CDD:237987 37/112 (33%)
armadillo repeat 242..267 CDD:293788 7/24 (29%)
armadillo repeat 275..311 CDD:293788 14/35 (40%)
armadillo repeat 317..352 CDD:293788 8/34 (24%)
ARM 320..437 CDD:237987 28/116 (24%)
armadillo repeat 360..393 CDD:293788 5/32 (16%)
armadillo repeat 403..435 CDD:293788 9/31 (29%)
Arm_3 451..494 CDD:292804 13/38 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.