DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and IMPA-9

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_195927.2 Gene:IMPA-9 / 831675 AraportID:AT5G03070 Length:519 Species:Arabidopsis thaliana


Alignment Length:453 Identity:100/453 - (22%)
Similarity:183/453 - (40%) Gaps:83/453 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KAELQKELTIYNALTKCKLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIAS 92
            |..:||.:|....|.  :|.|....|.|...|::..|..||:.|..|:.::...::|..|.:||:
plant    94 KGAMQKRVTALRELR--RLLSKSEFPPVEAALRAGAIPLLVQCLSFGSPDEQLLESAWCLTNIAA 156

  Fly    93 GSSEHSNLIAKAGAVPRLI-RLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSII 156
            |..|.:.  |...|:|.|| .|.:.....|.|:...::||:.....:||:.::..|.:..|..:|
plant   157 GKPEETK--ALLPALPLLIAHLGEKSSAPVAEQCAWAIGNVAGEGEDLRNVLLSQGALPPLARMI 219

  Fly   157 -QDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHG 220
             .||.:   .:....|.|..|.    ..|...||..:..::.:|         ||::  |:|...
plant   220 FPDKGS---TVRTAAWALSNLI----KGPESKAAAQLVKIDGIL---------DAIL--RHLKKT 266

  Fly   221 NETIQMLLDFEVVPRIIYLLEHPNVT----VQNAALQALIN-IATGSEEQIQELLNNNLLPHLSA 280
            :|....    |:...|:||....::.    ::...||.||: :||.|..|:       |:|.|.:
plant   267 DEETAT----EIAWIIVYLSALSDIATSMLLKGGILQLLIDRLATSSSLQL-------LIPVLRS 320

  Fly   281 L-----------------MSNSDPDI-----RC-----QVLK-----LLLNIADGNIFQRHAIMN 313
            |                 ..|::..|     :|     :|||     :|.|||.|:|..:..|.:
plant   321 LGNFVAVDPKAVLTILIREQNTEESIIGVLAKCLRSEHRVLKKEAAWVLSNIAAGSIEHKRMIHS 385

  Fly   314 AGLLHKILECLKADAISLKSAAALTITTLAI-----DKDKNL----LCYLMRQGVIPEFCNLLFC 369
            ..::..:|..|......::...|..:..|.:     |:...:    |..::..|.:..|..|:..
plant   386 TEVMPLLLRILSTSPFDIRKEVAYVLGNLCVESAEGDRKPRIIQEHLVSIVSGGCLRGFIELVRS 450

  Fly   370 QERDILSNVLDILSTMLDVDPSFSAEVSGIIEWSGALNNIRMLQSSEHEEIAAVARKIIGNYF 432
            .:.:.....|..:..:|...|  :.|...::|....::.:...|..|:||:..:|..::..||
plant   451 PDIEAARLGLQFIELVLRGMP--NGEGPKLVEGEDGIDAMERFQFHENEELRVMANSLVDKYF 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 31/121 (26%)
armadillo repeat 98..134 CDD:293788 10/36 (28%)
armadillo repeat 140..176 CDD:293788 8/36 (22%)
ARM 189..301 CDD:237987 31/148 (21%)
armadillo repeat 192..217 CDD:293788 4/24 (17%)
armadillo repeat 224..260 CDD:293788 8/40 (20%)
armadillo repeat 266..300 CDD:293788 11/65 (17%)
ARM 276..385 CDD:237987 26/149 (17%)
armadillo repeat 308..342 CDD:293788 4/33 (12%)
armadillo repeat 350..383 CDD:293788 5/36 (14%)
Arm_3 400..>433 CDD:292804 8/33 (24%)
IMPA-9NP_195927.2 SRP1 24..519 CDD:227396 100/453 (22%)
ARM 120..238 CDD:237987 31/122 (25%)
armadillo repeat 121..154 CDD:293788 8/32 (25%)
armadillo repeat 162..197 CDD:293788 10/36 (28%)
armadillo repeat 203..237 CDD:293788 8/36 (22%)
ARM 205..326 CDD:237987 33/149 (22%)
armadillo repeat 247..283 CDD:293788 10/50 (20%)
armadillo repeat 289..323 CDD:293788 12/40 (30%)
armadillo repeat 342..372 CDD:293788 6/29 (21%)
ARM 343..454 CDD:237987 21/110 (19%)
armadillo repeat 380..422 CDD:293788 5/41 (12%)
Arm_3 478..519 CDD:292804 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.