DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and IMPA-7

DIOPT Version :10

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_187223.1 Gene:IMPA-7 / 819741 AraportID:AT3G05720 Length:528 Species:Arabidopsis thaliana


Alignment Length:396 Identity:113/396 - (28%)
Similarity:193/396 - (48%) Gaps:20/396 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVPRLIRLLQSPDP 119
            |.:::::..:...||.|...:..:::.:||.||.:||||:||::.::...|||..|:|||.||..
plant    96 VEEVIQAGLVPRFVEFLTWDDSPQLQFEAAWALTNIASGTSENTEVVIDHGAVAILVRLLNSPYD 160

  Fly   120 EVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRKLCISSQPSP 184
            .|.|:.:.:|||:...:|..||.::.|..:..|:..:...:..: ||.:..|.|..|| ..:|.|
plant   161 VVREQVVWALGNISGDSPRCRDIVLGHAALPSLLLQLNHGAKLS-MLVNAAWTLSNLC-RGKPQP 223

  Fly   185 P-DNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPRIIYLLEHPNVTV 247
            | |..:..:.||..::...:..:|.....|:..|:.| ||.||.:::..|..|:|.|..|.:.:|
plant   224 PFDQVSAALPALAQLIRLDDKELLAYTCWALVYLSDGSNEKIQAVIEANVCARLIGLSIHRSPSV 288

  Fly   248 QNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNS-DPDIRCQVLKLLLNIADGNIFQRHAI 311
            ...||:.:.||.||::.|.|.:::...||.|..|:..| :..||.:....:.||..|...|..|:
plant   289 ITPALRTIGNIVTGNDSQTQHIIDLQALPCLVNLLRGSYNKTIRKEACWTVSNITAGCQSQIQAV 353

  Fly   312 MNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNLLFCQERDILS 376
            .:|.:...::..|:.....:|..||..|...........:.:|::|..|...|:||.|.:..::.
plant   354 FDADICPALVNLLQNSEGDVKKEAAWAICNAIAGGSYKQIMFLVKQECIKPLCDLLTCSDTQLVM 418

  Fly   377 NVLDILSTMLDVDPSFSA-EVSGI--------------IEWSGALNNIRMLQSSEHEEIAAVARK 426
            ..|:.|..:|.|...||: ...||              ||.:..|..|..|||.|:.:|...|.|
plant   419 VCLEALKKILKVGEVFSSRHAEGIYQCPQTNVNPHAQLIEEAEGLEKIEGLQSHENNDIYETAVK 483

  Fly   427 IIGNYF 432
            |:..|:
plant   484 ILETYW 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 SRP1 45..432 CDD:227396 112/394 (28%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 8/35 (23%)
armadillo repeat 192..217 CDD:293788 4/24 (17%)
armadillo repeat 224..260 CDD:293788 12/35 (34%)
armadillo repeat 266..300 CDD:293788 8/34 (24%)
armadillo repeat 308..342 CDD:293788 7/33 (21%)
armadillo repeat 350..383 CDD:293788 8/32 (25%)
IMPA-7NP_187223.1 SRP1 24..489 CDD:227396 112/394 (28%)
armadillo repeat 62..86 CDD:293788
armadillo repeat 99..131 CDD:293788 7/31 (23%)
armadillo repeat 139..175 CDD:293788 14/35 (40%)
armadillo repeat 181..216 CDD:293788 8/35 (23%)
armadillo repeat 232..257 CDD:293788 4/24 (17%)
armadillo repeat 265..301 CDD:293788 12/35 (34%)
armadillo repeat 307..342 CDD:293788 8/34 (24%)
armadillo repeat 350..387 CDD:293788 7/36 (19%)
armadillo repeat 393..427 CDD:293788 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.