DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna1

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_701359.5 Gene:kpna1 / 572542 ZFINID:ZDB-GENE-091116-39 Length:580 Species:Danio rerio


Alignment Length:398 Identity:116/398 - (29%)
Similarity:198/398 - (49%) Gaps:12/398 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|.......::.:||..|.:||||:|..:.::.:|||||
Zfish   151 KLLSKEPNPPIDEVIATPGVVERFVEFLKRRENCTLQFEAAWVLTNIASGTSHQTRVVIQAGAVP 215

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|.:|.|...:|.|:.:.:|||:...:...|||::...::..|:.::..::..|:|.:.| |.|
Zfish   216 IFIEMLSSDFEDVQEQAVWALGNIAGDSTECRDYVLDCNILPSLVQLLAKQNRLTMMRNAV-WAL 279

  Fly   174 RKLCISSQPSPPDNA--AEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPR 235
            ..||....| |||.|  :..:..|:.:|:..:.::|.||..|:..|:.| ||.||.::|..|..|
Zfish   280 SNLCRGKNP-PPDFAKVSPCLSVLSWLLFVNDTDILADACWALSYLSDGPNEKIQAVIDSGVCRR 343

  Fly   236 IIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNI 300
            ::.||.|....|.:.||:|:.||.||.:.|.|.:||.:.|..|..|:|:....|:.:....:.||
Zfish   344 LVELLLHAEYKVVSPALRAVGNIVTGDDLQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI 408

  Fly   301 ADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCN 365
            ..||..|...:::|.|...::..|:......:..||..||..........:.:|:..|.|...|:
Zfish   409 TAGNRAQIQMVIDADLFPPLISILQVAEFRTRKEAAWAITNATSGGSAEQIRHLVELGCIKPLCD 473

  Fly   366 LLFCQERDILSNVLDILSTMLDVDPSFSAEVSGI------IEWSGALNNIRMLQSSEHEEIAAVA 424
            ||...:..|:...|:.|..:|.:....:....||      ||.:..|:.:..||..|::||...|
Zfish   474 LLTLMDSKIVQVALNGLENILRLGELEAKRGGGINPYCALIEEAYGLDKLEFLQGHENQEIYQKA 538

  Fly   425 RKIIGNYF 432
            ..:|..||
Zfish   539 FDLIERYF 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 33/120 (28%)
armadillo repeat 98..134 CDD:293788 13/35 (37%)
armadillo repeat 140..176 CDD:293788 9/35 (26%)
ARM 189..301 CDD:237987 36/112 (32%)
armadillo repeat 192..217 CDD:293788 6/24 (25%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 25/108 (23%)
armadillo repeat 308..342 CDD:293788 7/33 (21%)
armadillo repeat 350..383 CDD:293788 8/32 (25%)
Arm_3 400..>433 CDD:292804 12/33 (36%)
kpna1XP_701359.5 IBB 47..147 CDD:280005
SRP1 50..557 CDD:227396 116/398 (29%)
ARM 163..284 CDD:237987 34/121 (28%)
armadillo repeat 171..197 CDD:293788 6/25 (24%)
armadillo repeat 205..241 CDD:293788 13/35 (37%)
armadillo repeat 247..282 CDD:293788 9/35 (26%)
ARM 248..368 CDD:237987 39/121 (32%)
armadillo repeat 299..324 CDD:293788 6/24 (25%)
armadillo repeat 332..368 CDD:293788 14/35 (40%)
armadillo repeat 374..408 CDD:293788 8/33 (24%)
armadillo repeat 416..452 CDD:293788 7/35 (20%)
ARM 417..547 CDD:237987 31/130 (24%)
armadillo repeat 459..493 CDD:293788 9/33 (27%)
Arm_3 508..558 CDD:292804 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.