DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna5

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001018163.1 Gene:kpna5 / 553205 ZFINID:ZDB-GENE-050522-22 Length:539 Species:Danio rerio


Alignment Length:399 Identity:119/399 - (29%)
Similarity:201/399 - (50%) Gaps:13/399 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|...:...::.:||.||.:||||:.:|:.::.:.||||
Zfish   109 KLLSKEPNPPIDEVIGTPGVVNRFVEFLRRSDNCTLQFEAAWALTNIASGTFQHTKVVIETGAVP 173

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|.||.|...:|.|:.:.:|||:.......|||::..|::..|..::. ||.......:..|.|
Zfish   174 IFIELLNSEYEDVQEQAVWALGNIAGDNAECRDYVLNCGILPSLQQLLA-KSNRLTTTRNAVWAL 237

  Fly   174 RKLCISSQPSPPDNA--AEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPR 235
            ..||....| |||.|  :..:..|:.:|::.:.:||.||..|:..|:.| |:.||.::|..|..|
Zfish   238 SNLCRGKNP-PPDFAKVSPCLSVLSRLLFSSDPDVLADACWALSYLSDGPNDKIQTVIDSGVCRR 301

  Fly   236 IIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNI 300
            ::.||.|.:..|.:.||:|:.||.||.:.|.|.:||.:.||.|..|:|:....|:.:....:.||
Zfish   302 LVELLMHSDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIKKEACWTVSNI 366

  Fly   301 ADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCN 365
            ..||..|..|::::.:...::|.|:......:..||..||..........:.||:....|...|:
Zfish   367 TAGNRAQIQAVIDSNVFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLNTIKPMCD 431

  Fly   366 LLFCQERDILSNVLDILSTMLDVDPSFSAE-------VSGIIEWSGALNNIRMLQSSEHEEIAAV 423
            ||...:..|:...|:.|..:|.:....|.:       ...:||.:..|:.|..|||.|::||...
Zfish   432 LLTVMDSKIVQVALNGLENILRLGEQESKQNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQK 496

  Fly   424 ARKIIGNYF 432
            |..:|.:||
Zfish   497 AFDLIEHYF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 34/120 (28%)
armadillo repeat 98..134 CDD:293788 13/35 (37%)
armadillo repeat 140..176 CDD:293788 9/35 (26%)
ARM 189..301 CDD:237987 37/112 (33%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 9/33 (27%)
ARM 276..385 CDD:237987 26/108 (24%)
armadillo repeat 308..342 CDD:293788 7/33 (21%)
armadillo repeat 350..383 CDD:293788 8/32 (25%)
Arm_3 400..>433 CDD:292804 14/33 (42%)
kpna5NP_001018163.1 IBB 9..105 CDD:280005
SRP1 36..521 CDD:227396 119/399 (30%)
HEAT repeat 88..117 CDD:293787 4/7 (57%)
ARM 121..242 CDD:237987 35/121 (29%)
armadillo repeat 129..155 CDD:293788 7/25 (28%)
armadillo repeat 163..199 CDD:293788 13/35 (37%)
armadillo repeat 205..240 CDD:293788 9/35 (26%)
ARM 254..368 CDD:237987 38/113 (34%)
armadillo repeat 257..282 CDD:293788 7/24 (29%)
armadillo repeat 290..326 CDD:293788 14/35 (40%)
armadillo repeat 332..366 CDD:293788 9/33 (27%)
ARM 333..451 CDD:237987 30/117 (26%)
armadillo repeat 374..410 CDD:293788 7/35 (20%)
armadillo repeat 417..451 CDD:293788 9/33 (27%)
Arm_3 467..513 CDD:292804 14/39 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.