DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and Spag6l

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_056588.1 Gene:Spag6l / 50525 MGIID:1354388 Length:507 Species:Mus musculus


Alignment Length:360 Identity:78/360 - (21%)
Similarity:155/360 - (43%) Gaps:57/360 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KIRADAADALAHIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDY 142
            |.|......:|.:|: ..::...:..||.:..|..||....|.:.:...|:||.|.::..:|.:.
Mouse    15 KARTQFVQMVAELAT-RPQNIETLQNAGVMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEA 78

  Fly   143 IIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAAEII-----QALNIVLYNP 202
            :::..::.:|:..:.:::  ........:|||.:...|    |..|..|:     ..|.|.|.:.
Mouse    79 VVKGDILPQLVYSLAEQN--RFYKKAAAFVLRAVGKHS----PQLAQAIVDCGALDTLVICLEDF 137

  Fly   203 EANVLEDALMAVRNLA-HGNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQI 266
            :..|.|.|..|:..:| |..|..|.::|...:|.::..::.|.:.::..|..||.:|:..|.|..
Mouse   138 DPGVKEAAAWALGYIARHNTELSQAVVDAGAIPLLVLCIQEPEIALKRIAASALSDISKHSPELA 202

  Fly   267 QELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISL 331
            |.:::...:.||:.::.|.|..::.|||..|..||..::.....::.|.:...:|.|||      
Mouse   203 QTVVDAGAIAHLAQMILNPDAKLKRQVLSALSQIAKHSVDLAEMVVEAEIFPVVLTCLK------ 261

  Fly   332 KSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNLLFCQERDILSNVLDILSTMLDVDPSFSAEV 396
                         |||:    |:.:..     |.|:    |:|..:..::...:::     :..|
Mouse   262 -------------DKDE----YVKKNA-----CTLI----REIAKHTPELSQLIVN-----AGGV 295

  Fly   397 SGIIEWSGA------LNNIRML-QSSEHEEIAAVA 424
            :.:|:..|:      |..|.|| ..:.|.|..|:|
Mouse   296 AAVIDCIGSCKGNIRLPGIMMLGYVAAHSENLAMA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 19/98 (19%)
armadillo repeat 98..134 CDD:293788 10/35 (29%)
armadillo repeat 140..176 CDD:293788 4/35 (11%)
ARM 189..301 CDD:237987 30/117 (26%)
armadillo repeat 192..217 CDD:293788 7/29 (24%)
armadillo repeat 224..260 CDD:293788 8/35 (23%)
armadillo repeat 266..300 CDD:293788 9/33 (27%)
ARM 276..385 CDD:237987 23/108 (21%)
armadillo repeat 308..342 CDD:293788 5/33 (15%)
armadillo repeat 350..383 CDD:293788 5/32 (16%)
Arm_3 400..>433 CDD:292804 10/32 (31%)
Spag6lNP_056588.1 ARM 1 31..70 10/38 (26%)
SRP1 <34..183 CDD:227396 33/154 (21%)
HEAT repeat 42..73 CDD:293787 8/30 (27%)
ARM 2 73..112 5/40 (13%)
HEAT repeat 85..109 CDD:293787 3/25 (12%)
SRP1 112..>423 CDD:227396 59/260 (23%)
ARM 3 115..154 10/38 (26%)
armadillo repeat 120..152 CDD:293788 8/31 (26%)
ARM 4 157..196 9/38 (24%)
armadillo repeat 160..196 CDD:293788 8/35 (23%)
ARM 5 199..238 11/38 (29%)
armadillo repeat 202..236 CDD:293788 9/33 (27%)
ARM 6 241..280 13/70 (19%)
armadillo repeat 244..278 CDD:293788 12/65 (18%)
ARM 7 325..365 3/6 (50%)
armadillo repeat 328..360 CDD:293788 2/3 (67%)
HEAT repeat 378..406 CDD:293787
ARM 8 402..441
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.