DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna6

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001008018.1 Gene:kpna6 / 493380 XenbaseID:XB-GENE-946491 Length:534 Species:Xenopus tropicalis


Alignment Length:398 Identity:122/398 - (30%)
Similarity:209/398 - (52%) Gaps:11/398 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|...:...::.:||.||.:||||:|:.:.::.:|||||
 Frog   104 KLLSKEPNPPIDEVINAPGVVERFVEFLKKSDNYTLQFEAAWALTNIASGTSQQTKIVIEAGAVP 168

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|:||.|...:|.|:.:.:|||:...:...|||::...::..|:::: .|||...|..:..|.|
 Frog   169 IFIQLLNSDYEDVQEQAVWALGNIAGDSSVCRDYVLSCDILPPLLNLL-TKSTRLTMTRNAVWAL 232

  Fly   174 RKLCISSQPSPP-DNAAEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPRI 236
            ..||....|.|. |..::.:..|:.:|::.::::|.||..|:..|:.| ||.||.::|..|..|:
 Frog   233 SNLCRGKNPPPDFDKVSQCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRRL 297

  Fly   237 IYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIA 301
            :.||.|.:..|.:.||:|:.||.||.:.|.|.:||.:.||.|..|:|:....||.:....:.||.
 Frog   298 VELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTISNIT 362

  Fly   302 DGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCNL 366
            .||..|..|:.:|.:...::|.|:......:..||..||..........:.||:..|.|...|:|
 Frog   363 AGNRGQIQAVADANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVNLGCIKPLCDL 427

  Fly   367 LFCQERDILSNVLDILSTMLDVDPSFSAE-------VSGIIEWSGALNNIRMLQSSEHEEIAAVA 424
            |...:..|:...|:.|..:|.:....:.:       ..|:||.:..|:.|..|||.|::||...|
 Frog   428 LTVMDSKIVQVALNGLENILRLGEQEAKQGGNGINPYCGLIEEAYGLDKIEFLQSHENQEIYQKA 492

  Fly   425 RKIIGNYF 432
            .::|.:||
 Frog   493 FELIEHYF 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 36/120 (30%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 10/35 (29%)
ARM 189..301 CDD:237987 38/112 (34%)
armadillo repeat 192..217 CDD:293788 6/24 (25%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 10/33 (30%)
ARM 276..385 CDD:237987 29/108 (27%)
armadillo repeat 308..342 CDD:293788 8/33 (24%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 14/33 (42%)
kpna6NP_001008018.1 SRP1 33..511 CDD:227396 122/398 (31%)
armadillo repeat 117..150 CDD:293788 7/32 (22%)
armadillo repeat 158..194 CDD:293788 14/35 (40%)
armadillo repeat 200..235 CDD:293788 10/35 (29%)
armadillo repeat 252..277 CDD:293788 6/24 (25%)
armadillo repeat 285..321 CDD:293788 14/35 (40%)
armadillo repeat 327..361 CDD:293788 10/33 (30%)
armadillo repeat 369..405 CDD:293788 8/35 (23%)
armadillo repeat 412..446 CDD:293788 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.