DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and spag6

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001002210.1 Gene:spag6 / 431757 ZFINID:ZDB-GENE-040704-53 Length:507 Species:Danio rerio


Alignment Length:388 Identity:90/388 - (23%)
Similarity:161/388 - (41%) Gaps:53/388 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KIRADAADALAHIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDY 142
            |.|......:|.:|: ..::|..:..||.:..|..||....|.:.:...|:||.|.::..:|.:.
Zfish    15 KARTQFVQTVADLAT-RPQNSETLQNAGVMSLLRPLLLDAVPTIQQTAALALGRLANYNDDLAEA 78

  Fly   143 IIRHGLMQKLMSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAAEI-----IQALNIVLYNP 202
            :::..::.:|:..:.:::  ........:|||.:...|    |:.|..:     :.||.|.|...
Zfish    79 VVKGDILPQLVYSLAEQN--RFYKKAAAFVLRAVAKHS----PELAQAVVDCGAVDALVISLEEF 137

  Fly   203 EANVLEDALMAVRNLA-HGNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQI 266
            :..|.|.|..|:.|:| |..:..|.::|..|||.::..::.|.:.::..|..||.:||..|.|..
Zfish   138 DPGVKEAAAWAIGNIARHNGQLSQAVVDAGVVPLLVLCIQEPEIALKRVAASALSDIAKHSPELA 202

  Fly   267 QELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLK-ADAIS 330
            |.:::...:.||:.::.|.|..::.||...|..||..::.....::.|.:....|.||| .|...
Zfish   203 QTVVDTGAIAHLAQMILNPDAKLKRQVFSALGQIAKHSVDVAEMVVEAEIFPAALVCLKDPDEYV 267

  Fly   331 LKSAAAL-----------------------TITTLAIDKDKNLLCYLMRQGVIPEFC-NLLFCQE 371
            .|:.|.|                       .|..|...|....|..:|..|.:.... ||.... 
Zfish   268 RKNVATLIREITKHTPELSQMIVNVGGVAAVIDYLGDSKGNVRLPGIMMLGYVAAHSENLAMAV- 331

  Fly   372 RDILSNVLDILSTMLDVDPSFSAEVSGIIEWS-GALNNIRMLQSSEHEEIAAVARKIIGNYFP 433
              |:|..:..|:..|:.:.  ...|...|.|: |.:..    .:.||.::.|||     |.||
Zfish   332 --IVSKGVPQLAICLEEEQ--EDHVKAAIAWAFGQIGR----HTPEHAKVVAVA-----NVFP 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 20/98 (20%)
armadillo repeat 98..134 CDD:293788 11/35 (31%)
armadillo repeat 140..176 CDD:293788 4/35 (11%)
ARM 189..301 CDD:237987 32/117 (27%)
armadillo repeat 192..217 CDD:293788 8/24 (33%)
armadillo repeat 224..260 CDD:293788 10/35 (29%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 29/133 (22%)
armadillo repeat 308..342 CDD:293788 10/57 (18%)
armadillo repeat 350..383 CDD:293788 7/33 (21%)
Arm_3 400..>433 CDD:292804 9/33 (27%)
spag6NP_001002210.1 armadillo repeat 37..68 CDD:293788 9/30 (30%)
ARM 77..195 CDD:237987 27/123 (22%)
armadillo repeat 78..110 CDD:293788 4/33 (12%)
armadillo repeat 120..152 CDD:293788 8/31 (26%)
armadillo repeat 160..196 CDD:293788 10/35 (29%)
ARM 161..279 CDD:237987 32/117 (27%)
armadillo repeat 202..233 CDD:293788 7/30 (23%)
armadillo repeat 244..278 CDD:293788 9/33 (27%)
ARM 245..363 CDD:237987 25/122 (20%)
HEAT repeat 293..316 CDD:293787 4/22 (18%)
HEAT repeat 327..363 CDD:293787 9/40 (23%)
ARM 330..432 CDD:237987 16/66 (24%)
HEAT repeat 378..406 CDD:293787 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.