DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna1

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_989192.1 Gene:kpna1 / 394800 XenbaseID:XB-GENE-1014184 Length:538 Species:Xenopus tropicalis


Alignment Length:400 Identity:118/400 - (29%)
Similarity:201/400 - (50%) Gaps:15/400 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|.......::.:||..|.:||||:|..:.::.:|||||
 Frog   108 KLLSKEPNPPIDEVIGTPGVVARFVEFLKRKENCTLQFEAAWVLTNIASGNSVQTRIVIQAGAVP 172

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|.||.|...:|.|:.:.:|||:...:...|||::...::..|:.::..::..| |..:..|.|
 Frog   173 IFIELLSSEFEDVQEQAVWALGNIAGDSTVCRDYVLDCNILPPLLQLLSKQNRLT-MTRNAVWAL 236

  Fly   174 RKLCISSQPSPPDNA--AEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPR 235
            ..||....| ||:.|  :..:..|:.:|:..:.:||.||..|:..|:.| |:.||.::|..|..|
 Frog   237 SNLCRGKNP-PPEFAKVSPCLTVLSWLLFVNDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRR 300

  Fly   236 IIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNI 300
            ::.||.|.:..|.:.||:|:.||.||.:.|.|.:||.:.|..|..|:|:....|:.:....:.||
 Frog   301 LVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNI 365

  Fly   301 ADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCN 365
            ..||..|...::.|.:...::..|:......:..||..||..........:.||:..|.|...|:
 Frog   366 TAGNRVQIQTVIEANIFPALINILQTAEFRTRKEAAWAITNATSGGSAEQIRYLVDLGCIKPLCD 430

  Fly   366 LLFCQERDILSNVLDILSTMLDVDPSFSAEVSG--------IIEWSGALNNIRMLQSSEHEEIAA 422
            ||.|.:..|:...|:.|..:|.:... .|:.:|        :||.:..|:.|..|||.|::||..
 Frog   431 LLTCMDSKIVQVALNGLENILRLGEQ-EAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQ 494

  Fly   423 VARKIIGNYF 432
            .|..:|.:||
 Frog   495 KAFDLIEHYF 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 33/120 (28%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 8/35 (23%)
ARM 189..301 CDD:237987 36/112 (32%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 26/108 (24%)
armadillo repeat 308..342 CDD:293788 6/33 (18%)
armadillo repeat 350..383 CDD:293788 10/32 (31%)
Arm_3 400..>433 CDD:292804 13/32 (41%)
kpna1NP_989192.1 SRP1 1..516 CDD:227396 117/399 (29%)
HEAT repeat 88..116 CDD:293787 4/7 (57%)
armadillo repeat 128..154 CDD:293788 6/25 (24%)
armadillo repeat 162..198 CDD:293788 14/35 (40%)
armadillo repeat 204..239 CDD:293788 8/35 (23%)
armadillo repeat 256..281 CDD:293788 7/24 (29%)
armadillo repeat 289..325 CDD:293788 14/35 (40%)
armadillo repeat 331..365 CDD:293788 8/33 (24%)
armadillo repeat 373..409 CDD:293788 6/35 (17%)
armadillo repeat 416..450 CDD:293788 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.