DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and KPNA3

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_002258.2 Gene:KPNA3 / 3839 HGNCID:6396 Length:521 Species:Homo sapiens


Alignment Length:476 Identity:163/476 - (34%)
Similarity:255/476 - (53%) Gaps:48/476 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RKRRFLKKGQNLMMLR------TLRLEKAKKAE--LQK-------------------------EL 35
            |.:.|..||:::..:|      |:.|.|.|:.|  |:|                         |.
Human    11 RIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEA 75

  Fly    36 TIYNALT------------KCKLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALA 88
            .:.||.:            ..||.||:..|.::.|:||..:..||:.|...:...::.:||.||.
Human    76 ILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALT 140

  Fly    89 HIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLM 153
            :||||:|..:..:.::.|||..:|||:||...|||:.:.:|||::...|..|||:|..|:::.|:
Human   141 NIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLL 205

  Fly   154 SIIQDKSTCTLMLSHVTWVLRKLCISSQPSPP-DNAAEIIQALNIVLYNPEANVLEDALMAVRNL 217
            |.|......| .|.:||||:..||.:..|.|| :...||:.||.:::|:.:.|:|.|.:.|:..|
Human   206 SFISPSIPIT-FLRNVTWVIVNLCRNKDPPPPMETVQEILPALCVLIYHTDINILVDTVWALSYL 269

  Fly   218 AH-GNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSAL 281
            .. |||.|||::|..|||.::.||.|..|.||.|||:|:.||.||::||.|.:||.::|.|...|
Human   270 TDGGNEQIQMVIDSGVVPFLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDVLSHFPNL 334

  Fly   282 MSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDK 346
            :|:....|..:.:..|.||..||..|..|:::|||:..|:..|.......:..||..|:.|.|..
Human   335 LSHPKEKINKEAVWFLSNITAGNQQQVQAVIDAGLIPMIIHQLAKGDFGTQKEAAWAISNLTISG 399

  Fly   347 DKNLLCYLMRQGVIPEFCNLLFCQERDILSNVLDILSTMLDVDPSFSAEVSGIIEWSGALNNIRM 411
            .|:.:.||::|.|||.|||||..::..::..|||.|..:|.:....::.::.|||..|.|..|.:
Human   400 RKDQVEYLVQQNVIPPFCNLLSVKDSQVVQVVLDGLKNILIMAGDEASTIAEIIEECGGLEKIEV 464

  Fly   412 LQSSEHEEIAAVARKIIGNYF 432
            ||..|:|:|..:|.:||..||
Human   465 LQQHENEDIYKLAFEIIDQYF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 44/119 (37%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 14/35 (40%)
ARM 189..301 CDD:237987 46/112 (41%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 19/35 (54%)
armadillo repeat 266..300 CDD:293788 9/33 (27%)
ARM 276..385 CDD:237987 37/108 (34%)
armadillo repeat 308..342 CDD:293788 9/33 (27%)
armadillo repeat 350..383 CDD:293788 14/32 (44%)
Arm_3 400..>433 CDD:292804 15/33 (45%)
KPNA3NP_002258.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 5/17 (29%)
SRP1 2..521 CDD:227396 163/476 (34%)
Nuclear localization signal. /evidence=ECO:0000250 43..52 3/8 (38%)
ARM 1, truncated 66..106 7/39 (18%)
armadillo repeat 73..98 CDD:293788 3/24 (13%)
ARM 2 107..149 15/41 (37%)
armadillo repeat 109..142 CDD:293788 10/32 (31%)
NLS binding site (major). /evidence=ECO:0000250 137..229 37/92 (40%)
armadillo repeat 150..186 CDD:293788 14/35 (40%)
armadillo repeat 192..227 CDD:293788 14/35 (40%)
ARM 4 195..233 13/38 (34%)
ARM 5 234..278 15/43 (35%)
armadillo repeat 244..269 CDD:293788 7/24 (29%)
armadillo repeat 277..313 CDD:293788 19/35 (54%)
ARM 6 279..318 19/38 (50%)
NLS binding site (minor). /evidence=ECO:0000250 306..394 30/87 (34%)
armadillo repeat 319..353 CDD:293788 9/33 (27%)
ARM 8 361..400 11/38 (29%)
armadillo repeat 361..395 CDD:293788 9/33 (27%)
ARM 9 401..443 17/41 (41%)
armadillo repeat 404..438 CDD:293788 15/33 (45%)
ARM 10, atypical 447..485 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143887
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.