DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and KPNA1

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_002255.3 Gene:KPNA1 / 3836 HGNCID:6394 Length:538 Species:Homo sapiens


Alignment Length:401 Identity:117/401 - (29%)
Similarity:200/401 - (49%) Gaps:17/401 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|.......::.::|..|.:||||:|..:.::.:|||||
Human   108 KLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVP 172

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|.||.|...:|.|:.:.:|||:...:...|||::...::..|:.:...::..| |..:..|.|
Human   173 IFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLT-MTRNAVWAL 236

  Fly   174 RKLCISSQPSPPDNAAEIIQALNI---VLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVP 234
            ..||...  |||...|::...||:   :|:..:.:||.||..|:..|:.| |:.||.::|..|..
Human   237 SNLCRGK--SPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCR 299

  Fly   235 RIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLN 299
            |::.||.|.:..|.:.||:|:.||.||.:.|.|.:||.:.|..|..|:|:....|:.:....:.|
Human   300 RLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISN 364

  Fly   300 IADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFC 364
            |..||..|...:::|.:...::..|:......:..||..||..........:.||:..|.|...|
Human   365 ITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLC 429

  Fly   365 NLLFCQERDILSNVLDILSTMLDVDPSFSAEVSG--------IIEWSGALNNIRMLQSSEHEEIA 421
            :||...:..|:...|:.|..:|.:... .|:.:|        :||.:..|:.|..|||.|::||.
Human   430 DLLTVMDSKIVQVALNGLENILRLGEQ-EAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIY 493

  Fly   422 AVARKIIGNYF 432
            ..|..:|.:||
Human   494 QKAFDLIEHYF 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 32/120 (27%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 8/35 (23%)
ARM 189..301 CDD:237987 38/115 (33%)
armadillo repeat 192..217 CDD:293788 8/27 (30%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 25/108 (23%)
armadillo repeat 308..342 CDD:293788 6/33 (18%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 14/33 (42%)
KPNA1NP_002255.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Arm_3 33..516 CDD:330530 117/401 (29%)
nuclear localization signal 42..51
ARM 1, truncated 77..117 4/8 (50%)
HEAT repeat 88..116 CDD:293787 4/7 (57%)
ARM 2 118..161 10/42 (24%)
armadillo repeat 128..154 CDD:293788 5/25 (20%)
NLS binding site (major). /evidence=ECO:0000250 149..241 29/92 (32%)
armadillo repeat 162..198 CDD:293788 14/35 (40%)
armadillo repeat 204..239 CDD:293788 8/35 (23%)
ARM 4 207..245 7/40 (18%)
Binding to RAG1 245..437 57/191 (30%)
armadillo repeat 256..281 CDD:293788 8/24 (33%)
armadillo repeat 289..325 CDD:293788 14/35 (40%)
NLS binding site (minor). /evidence=ECO:0000250 318..406 24/87 (28%)
armadillo repeat 373..409 CDD:293788 6/35 (17%)
ARM 9 413..457 11/44 (25%)
armadillo repeat 416..450 CDD:293788 10/33 (30%)
ARM 10, atypical 460..504 13/43 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.