DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and Kpna6

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001015029.2 Gene:Kpna6 / 362607 RGDID:1306570 Length:541 Species:Rattus norvegicus


Alignment Length:404 Identity:126/404 - (31%)
Similarity:209/404 - (51%) Gaps:23/404 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|.......::.:||.||.:||||:|:.:.::.:|||||
  Rat   111 KLLSKEPSPPIDEVINTPGVVDRFVEFLKRSENCTLQFEAAWALTNIASGTSQQTKIVIEAGAVP 175

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|.||.|...:|.|:.:.:|||:...:...|||::...::..|:::: .|||...|..:..|.|
  Rat   176 IFIELLNSDFEDVQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTLL-TKSTRLTMTRNAVWAL 239

  Fly   174 RKLCISSQPSPPDNA--AEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPR 235
            ..||....| ||:.|  :..:..|:.:|::.::::|.||..|:..|:.| ||.||.::|..|..|
  Rat   240 SNLCRGKNP-PPEFAKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRR 303

  Fly   236 IIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNI 300
            ::.||.|.:..|.:.||:|:.||.||.:.|.|.:||.:.||.|..|:|:|...||.:....:.||
  Rat   304 LVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLSSSKESIRKEACWTISNI 368

  Fly   301 ADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCN 365
            ..||..|..|:::|.:...::|.|:......:..||..||..........:.||:..|.|...|:
  Rat   369 TAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVSLGCIKPLCD 433

  Fly   366 LLFCQERDILSNVLDILSTML------------DVDPSFSAEVSGIIEWSGALNNIRMLQSSEHE 418
            ||...:..|:...|:.|..:|            .|:|     ..|:||.:..|:.|..|||.|::
  Rat   434 LLTVMDSKIVQVALNGLENILRLGEQEGKRSGSGVNP-----YCGLIEEAYGLDKIEFLQSHENQ 493

  Fly   419 EIAAVARKIIGNYF 432
            ||...|..:|.:||
  Rat   494 EIYQKAFDLIEHYF 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 36/120 (30%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 10/35 (29%)
ARM 189..301 CDD:237987 39/112 (35%)
armadillo repeat 192..217 CDD:293788 6/24 (25%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 11/33 (33%)
ARM 276..385 CDD:237987 30/108 (28%)
armadillo repeat 308..342 CDD:293788 8/33 (24%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 14/33 (42%)
Kpna6NP_001015029.2 SRP1 41..530 CDD:227396 126/404 (31%)
armadillo repeat 131..157 CDD:293788 7/25 (28%)
armadillo repeat 165..201 CDD:293788 14/35 (40%)
armadillo repeat 207..242 CDD:293788 10/35 (29%)
armadillo repeat 259..284 CDD:293788 6/24 (25%)
armadillo repeat 292..328 CDD:293788 14/35 (40%)
armadillo repeat 334..368 CDD:293788 11/33 (33%)
armadillo repeat 376..412 CDD:293788 8/35 (23%)
armadillo repeat 419..453 CDD:293788 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.