DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and Kpna5

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_006256504.1 Gene:Kpna5 / 294392 RGDID:1561324 Length:539 Species:Rattus norvegicus


Alignment Length:400 Identity:116/400 - (28%)
Similarity:201/400 - (50%) Gaps:15/400 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLL-KSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.::::: |...:...|:.|.......::.:||.||.:||||:..|:.::.:.||||
  Rat   109 KLLSKEPNPPIDQVIQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAVP 173

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..||||.|...:|.|:.:.:|||:.......||:::...::..|:.::.:.:..|...:.| |.|
  Rat   174 IFIRLLTSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLTNSNRLTTTRNAV-WAL 237

  Fly   174 RKLCISSQPSPPDNAAEIIQALNI---VLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVP 234
            ..||...  :||.|.:::...||:   :|::.:.:||.|...|:..|:.| |:.||:::|..|..
  Rat   238 SNLCRGK--NPPPNFSKVSPCLNVLSRLLFSSDPDVLADVCWALSYLSDGPNDKIQVVIDSGVCR 300

  Fly   235 RIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLN 299
            |::.||.|.:..|.:.||:|:.||.||.:.|.|.:||.:.||.|..|:.:....:|.:....:.|
  Rat   301 RLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALPCLLHLLGSPKESVRKEACWTISN 365

  Fly   300 IADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFC 364
            |..||..|..|:::..:...::|.|:......:..||..||..........:.||:..|.|...|
  Rat   366 ITAGNRMQIQAVIDGSIFPVLIEVLQKAEFRTRKEAAWAITNATSGGAPEQIRYLVTLGCIKPLC 430

  Fly   365 NLLFCQERDILSNVLDILSTMLDVDPSFSAE-------VSGIIEWSGALNNIRMLQSSEHEEIAA 422
            :||...:..|:...|:.|..:|.:....|.:       ...:||.:..|:.|..|||.|::||..
  Rat   431 DLLTVMDSKIVQVALNGLENILRLGERESKQNGVGINPYCALIEEAYGLDKIEFLQSHENQEIYQ 495

  Fly   423 VARKIIGNYF 432
            .|..:|..||
  Rat   496 KAFDLIERYF 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 33/120 (28%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 7/35 (20%)
ARM 189..301 CDD:237987 36/115 (31%)
armadillo repeat 192..217 CDD:293788 7/27 (26%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 8/33 (24%)
ARM 276..385 CDD:237987 26/108 (24%)
armadillo repeat 308..342 CDD:293788 7/33 (21%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 13/32 (41%)
Kpna5XP_006256504.1 IBB 9..105 CDD:280005
SRP1 36..528 CDD:227396 115/399 (29%)
ARM 121..242 CDD:237987 34/121 (28%)
armadillo repeat 122..155 CDD:293788 7/32 (22%)
armadillo repeat 163..199 CDD:293788 14/35 (40%)
armadillo repeat 205..240 CDD:293788 7/35 (20%)
ARM 254..368 CDD:237987 37/113 (33%)
armadillo repeat 257..282 CDD:293788 7/24 (29%)
armadillo repeat 290..326 CDD:293788 14/35 (40%)
armadillo repeat 332..366 CDD:293788 8/33 (24%)
ARM 333..451 CDD:237987 30/117 (26%)
armadillo repeat 374..410 CDD:293788 7/35 (20%)
armadillo repeat 417..451 CDD:293788 10/33 (30%)
Arm_3 467..511 CDD:292804 13/38 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.