DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and Spag6

DIOPT Version :10

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001099595.1 Gene:Spag6 / 291340 RGDID:1305616 Length:509 Species:Rattus norvegicus


Alignment Length:290 Identity:68/290 - (23%)
Similarity:133/290 - (45%) Gaps:36/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 IASGSSEHSNL--IAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKL 152
            :|..::...|:  :..||.:..|..||....|.:.:...|:||.|.::..:|.:.:::..::.:|
  Rat    24 VAEQATRPQNIETLQNAGIMSLLRPLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKGDILPQL 88

  Fly   153 MSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAAEI----IQALNIVLYNPEANVLEDALMA 213
            :..:.::: |....: ..:|||.:   .:.||....|.:    :.:|.|.|.:.:..|.|.|..|
  Rat    89 VYSLAEQN-CVYKKA-AAFVLRAV---GKHSPQLAQATVDCGALDSLVICLEDFDPGVKEAAAWA 148

  Fly   214 VRNLA-HGNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPH 277
            :..:| |..|..|.::|...||.::..::.|.:.::..|..||.:|:..|.|..|.:::...:.|
  Rat   149 LAYIARHNAELSQAVVDAGAVPLLVLCIQEPEIALKRIAASALSDISKHSPELAQTVVDVGAIAH 213

  Fly   278 LSALMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTL 342
            |:.::.|.|..::.|||..|.:||..::.....::.|.:...:|.|||                 
  Rat   214 LAQMILNPDEKLKQQVLSALSHIAKHSVDLAEMVVEAEIFPVVLTCLK----------------- 261

  Fly   343 AIDKD---KNLLCYLMRQGV--IPEFCNLL 367
              |||   |...|.|:|:..  .||...|:
  Rat   262 --DKDDFVKKNACTLIREIAKHTPELSQLI 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 SRP1 45..432 CDD:227396 68/290 (23%)
armadillo repeat 98..134 CDD:293788 11/37 (30%)
armadillo repeat 140..176 CDD:293788 5/35 (14%)
armadillo repeat 192..217 CDD:293788 7/24 (29%)
armadillo repeat 224..260 CDD:293788 9/35 (26%)
armadillo repeat 266..300 CDD:293788 9/33 (27%)
armadillo repeat 308..342 CDD:293788 5/33 (15%)
armadillo repeat 350..383 CDD:293788 6/20 (30%)
Spag6NP_001099595.1 armadillo repeat 76..108 CDD:293788 3/33 (9%)
SRP1 112..>423 CDD:227396 50/197 (25%)
armadillo repeat 127..152 CDD:293788 7/24 (29%)
armadillo repeat 162..194 CDD:293788 7/31 (23%)
armadillo repeat 202..238 CDD:293788 10/35 (29%)
armadillo repeat 244..278 CDD:293788 12/52 (23%)
armadillo repeat 328..360 CDD:293788
HEAT repeat 378..406 CDD:293787
armadillo repeat 34..70 CDD:293788 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.