DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and imp1

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_596632.1 Gene:imp1 / 2539928 PomBaseID:SPBC1604.08c Length:539 Species:Schizosaccharomyces pombe


Alignment Length:470 Identity:140/470 - (29%)
Similarity:245/470 - (52%) Gaps:42/470 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQKRKR-RFLKKGQNLMML-------------RTLRLEKAKKAELQK----------ELTIYNAL 41
            ::|:|| ..|.|.:||..:             ..:::|:..|.|..|          ||.: .|:
pombe    35 IRKQKREESLNKRRNLNAVLQNDIDVEEEADQSQVQMEQQMKDEFPKLTADVMSDDIELQL-GAV 98

  Fly    42 TKC-KLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAG 105
            ||. |..|.|..|.:::::....:...|:.| ....:.::.:||.||.:||||:::.:.::..:|
pombe    99 TKFRKYLSKETHPPIDQVIACGVVDRFVQFL-ESEHHLLQFEAAWALTNIASGTTDQTRIVVDSG 162

  Fly   106 AVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVT 170
            ||||.|:||.||:.:|.|:.:.:|||:...:...|||::.:|::|.|::|:|..::...||.:.|
pombe   163 AVPRFIQLLSSPEKDVREQVVWALGNIAGDSSACRDYVLGNGVLQPLLNILQSSASDVSMLRNAT 227

  Fly   171 WVLRKLCISSQPSPPDNAAEIIQALNI---VLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFE 231
            |.|..||...  :||.|.:.|..|:.|   :||:.:..::.||..|:..|:.| ||.|..:||..
pombe   228 WTLSNLCRGK--NPPPNWSTISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKIGAILDVG 290

  Fly   232 VVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKL 296
            ..||::.||..|:|.:|..||:::.||.||::.|.|.:::...|....:|:|:...:||.:....
pombe   291 CAPRLVELLSSPSVNIQTPALRSVGNIVTGTDAQTQIIIDCGALNAFPSLLSHQKENIRKEACWT 355

  Fly   297 LLNIADGNIFQRHAIMNAGLLHKILECLK-ADAISLKSAA-ALTITTLAIDKDKNLLCYLMRQGV 359
            :.||..||..|..||:.:.|:..::..|. ||..:.|.|. |::..|.......:.:.||:.|||
pombe   356 ISNITAGNTQQIQAIIESNLIPPLVHLLSYADYKTKKEACWAISNATSGGLGQPDQIRYLVSQGV 420

  Fly   360 IPEFCNLLFCQERDILSNVLDILSTML---DVDPSFSAE----VSGIIEWSGALNNIRMLQSSEH 417
            |...|::|...:..|:...||.:..:|   ::|.:...|    .:..:|.:|.::.|..||||.:
pombe   421 IKPLCDMLNGSDNKIIQVALDAIENILKVGEMDRTMDLENINQYAVYVEEAGGMDMIHDLQSSGN 485

  Fly   418 EEIAAVARKIIGNYF 432
            .:|...|..||..||
pombe   486 NDIYLKAYSIIEKYF 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 38/119 (32%)
armadillo repeat 98..134 CDD:293788 15/35 (43%)
armadillo repeat 140..176 CDD:293788 13/35 (37%)
ARM 189..301 CDD:237987 36/115 (31%)
armadillo repeat 192..217 CDD:293788 7/27 (26%)
armadillo repeat 224..260 CDD:293788 14/35 (40%)
armadillo repeat 266..300 CDD:293788 6/33 (18%)
ARM 276..385 CDD:237987 30/110 (27%)
armadillo repeat 308..342 CDD:293788 9/35 (26%)
armadillo repeat 350..383 CDD:293788 11/32 (34%)
Arm_3 400..>433 CDD:292804 13/33 (39%)
imp1NP_596632.1 SRP1 1..531 CDD:227396 140/470 (30%)
IBB 9..99 CDD:280005 14/64 (22%)
ARM 114..235 CDD:237987 39/121 (32%)
armadillo repeat 115..147 CDD:293788 6/32 (19%)
armadillo repeat 155..191 CDD:293788 15/35 (43%)
armadillo repeat 197..233 CDD:293788 13/35 (37%)
ARM 249..361 CDD:237987 36/111 (32%)
armadillo repeat 250..275 CDD:293788 6/24 (25%)
armadillo repeat 285..317 CDD:293788 11/31 (35%)
ARM 326..446 CDD:237987 32/119 (27%)
armadillo repeat 327..359 CDD:293788 5/31 (16%)
armadillo repeat 367..403 CDD:293788 9/35 (26%)
armadillo repeat 412..446 CDD:293788 11/33 (33%)
Arm_3 462..508 CDD:292804 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.