DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and Kpna3

DIOPT Version :10

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_032492.1 Gene:Kpna3 / 16648 MGIID:1100863 Length:521 Species:Mus musculus


Alignment Length:37 Identity:11/37 - (29%)
Similarity:20/37 - (54%) Gaps:4/37 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 NSFTTPIQSSNLGRRQRSYQNHFDHGES----SSASQ 513
            :|.::|.:|...||.::|.......|:|    |::||
Mouse   160 DSDSSPPRSRGRGRFEKSRIRGVSRGQSDDTRSTSSQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 SRP1 45..432 CDD:227396
armadillo repeat 98..134 CDD:293788
armadillo repeat 140..176 CDD:293788
armadillo repeat 192..217 CDD:293788
armadillo repeat 224..260 CDD:293788
armadillo repeat 266..300 CDD:293788
armadillo repeat 308..342 CDD:293788
armadillo repeat 350..383 CDD:293788
Kpna3NP_032492.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
SRP1 7..521 CDD:227396 11/37 (30%)
Nuclear localization signal. /evidence=ECO:0000250 43..52
ARM 1, truncated 66..106
armadillo repeat 73..98 CDD:293788
ARM 2 107..149
armadillo repeat 109..142 CDD:293788
NLS binding site (major). /evidence=ECO:0000250 137..229 11/37 (30%)
armadillo repeat 150..186 CDD:293788 6/25 (24%)
armadillo repeat 192..227 CDD:293788 3/5 (60%)
ARM 4 195..233 2/2 (100%)
ARM 5 234..278
armadillo repeat 244..269 CDD:293788
armadillo repeat 277..313 CDD:293788
ARM 6 279..318
NLS binding site (minor). /evidence=ECO:0000250 306..394
armadillo repeat 319..353 CDD:293788
ARM 8 361..400
armadillo repeat 361..395 CDD:293788
ARM 9 401..443
armadillo repeat 404..438 CDD:293788
ARM 10, atypical 447..485
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.