DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna4

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_002933281.2 Gene:kpna4 / 100380091 XenbaseID:XB-GENE-1011058 Length:520 Species:Xenopus tropicalis


Alignment Length:477 Identity:161/477 - (33%)
Similarity:253/477 - (53%) Gaps:48/477 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRKRRFLKKGQNLMMLRTLR------LEKAKKAE--LQK-------------------------E 34
            :|.:.|..||::|..:|..|      |.|.|:.|  |::                         |
 Frog    10 QRLKNFKNKGRDLESMRRQRNEVVVELRKNKRDEHLLKRRNVPHEDICEDSDVDADFRVQNTSLE 74

  Fly    35 LTIYNALT------------KCKLTSSEVVPDVNKLLKSNTIGNLVESLGHGNKNKIRADAADAL 87
            ..:.||.:            ..||.||:..|.::.|:||..:..||..|...:...::.:||.||
 Frog    75 AIVQNASSDHQGIQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVHCLERDDNPSLQFEAAWAL 139

  Fly    88 AHIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKL 152
            .:||||:||.:..:.::.|||..:|||.||...|||:.:.:|||::...|..|||:|..|:::.|
 Frog   140 TNIASGTSEQTQAVVQSNAVPLFLRLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPL 204

  Fly   153 MSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPP-DNAAEIIQALNIVLYNPEANVLEDALMAVRN 216
            :|.|......| .|.:||||:..||....|.|| :...||:.||.:::::.:.|:|.|.:.|:..
 Frog   205 LSFINPSIPIT-FLRNVTWVMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSY 268

  Fly   217 LAH-GNETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSA 280
            |.. |||.|||::|..:|..::.||.:|.|.||.|||:|:.||.||::||.|.:||.:.|.|..|
 Frog   269 LTDAGNEQIQMVIDSGIVTNLVPLLSNPEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALLHFPA 333

  Fly   281 LMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAID 345
            |::::...|..:.:..|.||..||..|..|:::|.|:..|:..|.......:..||..|:.|.|.
 Frog   334 LLTHAKEKINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTIS 398

  Fly   346 KDKNLLCYLMRQGVIPEFCNLLFCQERDILSNVLDILSTMLDVDPSFSAEVSGIIEWSGALNNIR 410
            ..|:.:.||::|.|||.|||||..::..::..|||.||.:|.:....|..::.:||..|.|..|.
 Frog   399 GRKDQVAYLIQQNVIPPFCNLLTVKDPQVIQVVLDGLSNILKMADEDSETIANLIEECGGLEKIE 463

  Fly   411 MLQSSEHEEIAAVARKIIGNYF 432
            .|||.|:|:|..:|.:||..:|
 Frog   464 QLQSHENEDIYKLAFEIIDQFF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 45/119 (38%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 14/35 (40%)
ARM 189..301 CDD:237987 43/112 (38%)
armadillo repeat 192..217 CDD:293788 6/24 (25%)
armadillo repeat 224..260 CDD:293788 17/35 (49%)
armadillo repeat 266..300 CDD:293788 9/33 (27%)
ARM 276..385 CDD:237987 37/108 (34%)
armadillo repeat 308..342 CDD:293788 8/33 (24%)
armadillo repeat 350..383 CDD:293788 14/32 (44%)
Arm_3 400..>433 CDD:292804 15/33 (45%)
kpna4XP_002933281.2 SRP1 11..519 CDD:227396 161/476 (34%)
armadillo repeat 73..98 CDD:293788 3/24 (13%)
armadillo repeat 109..142 CDD:293788 10/32 (31%)
armadillo repeat 150..186 CDD:293788 14/35 (40%)
armadillo repeat 192..227 CDD:293788 14/35 (40%)
armadillo repeat 244..269 CDD:293788 6/24 (25%)
armadillo repeat 279..311 CDD:293788 13/31 (42%)
armadillo repeat 319..355 CDD:293788 11/35 (31%)
armadillo repeat 361..395 CDD:293788 8/33 (24%)
armadillo repeat 404..438 CDD:293788 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23316
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.