DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna7

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001135557.1 Gene:kpna7 / 100216104 XenbaseID:XB-GENE-5991711 Length:523 Species:Xenopus tropicalis


Alignment Length:487 Identity:123/487 - (25%)
Similarity:225/487 - (46%) Gaps:63/487 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KRKRRFLKKGQNLMMLRTLRLE------KAKKAE---------------LQKELTIYNALTKCKL 46
            :|.|:|..||::...||..|:|      ||||.|               |..|..:..::....|
 Frog     9 ERMRKFKNKGKDTAELRRRRVEVNVELRKAKKDEQILKRRNVCFPEELVLSPEKNVMQSMQVPSL 73

  Fly    47 TSSEVV---------------------------PDVNKLLKSNTIGNLVESLGHGNKNKIRADAA 84
            :..|:|                           |.:|.::::..|..||:.|...:.:.::.:||
 Frog    74 SLEEIVQGMNSGDTENELRSTQAARKMLSRERNPPLNDIIEAGLIPKLVDFLSRHDNSTLQFEAA 138

  Fly    85 DALAHIASGSSEHSNLIAKAGAVPRLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLM 149
            .||.:||||:|:.:..:...||:|..|.|:.||...:.|:.:.:|||:....|..||.:|...::
 Frog   139 WALTNIASGTSDQTKSVVDGGAIPAFISLISSPHLHISEQAVWALGNIAGDGPMYRDSLINCNVI 203

  Fly   150 QKLMSIIQDKSTCTLMLSHVTWVLRKLCISSQPSPPDNAA-EIIQALNIVLYNPEANVLEDALMA 213
            ..|:::: :..|....|.::||.|..||.:..|.||.:|. :|:..|..:|::.:.::|.|...|
 Frog   204 PPLLALV-NPQTPIGYLRNITWTLSNLCRNKNPYPPMSAVLQILPVLTQLLHHEDKDILSDTCWA 267

  Fly   214 VRNLAHG-NETIQMLLDFEVVPRIIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPH 277
            :..|..| |:.|.:::...:|.|:|.|:..|.:::...:|:.:.||.||:::|.|..::..:|..
 Frog   268 MSYLTDGSNDRIDVVVKTGIVERLIQLMYSPELSILTPSLRTVGNIVTGTDKQTQAAIDVGVLSI 332

  Fly   278 LSALMSNSDPDIRCQVLKLLLNIADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTL 342
            |..|:.:..|.|:.:....|.|||.|...|...::..|||..:::.||......:..|...:|..
 Frog   333 LPQLLRHQKPSIQKEAAWALSNIAAGPAPQIQQMITCGLLSPLVDLLKKGDFKAQKEAVWAVTNY 397

  Fly   343 AIDKDKNLLCYLMRQGVIPEFCNLLFCQERDILSNVLDILSTMLDVDPSFSAEVSG-------II 400
            ........:..|::.||:....|||..::...:..:||.:|.:.     .:||..|       ::
 Frog   398 TSGGTVEQVVQLVQCGVLEPLLNLLTIKDSKTILVILDAISNIF-----LAAEKLGEQEKLCLLV 457

  Fly   401 EWSGALNNIRMLQSSEHEEIAAVARKIIGNYF 432
            |..|.|..|..||:.::..:...|..:|..||
 Frog   458 EELGGLEKIEALQTHDNHMVYHAALALIEKYF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 34/119 (29%)
armadillo repeat 98..134 CDD:293788 11/35 (31%)
armadillo repeat 140..176 CDD:293788 9/35 (26%)
ARM 189..301 CDD:237987 29/113 (26%)
armadillo repeat 192..217 CDD:293788 5/24 (21%)
armadillo repeat 224..260 CDD:293788 9/35 (26%)
armadillo repeat 266..300 CDD:293788 7/33 (21%)
ARM 276..385 CDD:237987 26/108 (24%)
armadillo repeat 308..342 CDD:293788 7/33 (21%)
armadillo repeat 350..383 CDD:293788 8/32 (25%)
Arm_3 400..>433 CDD:292804 10/33 (30%)
kpna7NP_001135557.1 SRP1 8..523 CDD:227396 123/487 (25%)
armadillo repeat 64..101 CDD:293788 3/36 (8%)
armadillo repeat 111..144 CDD:293788 8/32 (25%)
armadillo repeat 152..188 CDD:293788 11/35 (31%)
armadillo repeat 194..229 CDD:293788 9/35 (26%)
armadillo repeat 246..271 CDD:293788 5/24 (21%)
armadillo repeat 279..315 CDD:293788 9/35 (26%)
armadillo repeat 321..355 CDD:293788 7/33 (21%)
armadillo repeat 363..397 CDD:293788 7/33 (21%)
armadillo repeat 406..440 CDD:293788 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.