DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alphaKap4 and kpna6

DIOPT Version :9

Sequence 1:NP_648007.1 Gene:alphaKap4 / 38675 FlyBaseID:FBgn0035657 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_001923921.1 Gene:kpna6 / 100149852 ZFINID:ZDB-GENE-130530-626 Length:537 Species:Danio rerio


Alignment Length:400 Identity:123/400 - (30%)
Similarity:207/400 - (51%) Gaps:15/400 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KLTSSEVVPDVNKLLKS-NTIGNLVESLGHGNKNKIRADAADALAHIASGSSEHSNLIAKAGAVP 108
            ||.|.|..|.:::::.: ..:...||.|.......::.:||.||.:||||:|:.:..:.:|||||
Zfish   107 KLLSKEPNPPIDEVISTPGVVNRFVEFLQKSTNCTLQFEAAWALTNIASGTSQQTKFVIEAGAVP 171

  Fly   109 RLIRLLQSPDPEVCEKGILSLGNLLHFAPNLRDYIIRHGLMQKLMSIIQDKSTCTLMLSHVTWVL 173
            ..|.||.|...:|.|:.:.:|||:...:...|||::...::..|: ::..|||...|..:..|.|
Zfish   172 VFIELLNSDFEDVQEQAVWALGNIAGDSAVCRDYVLNCNILPPLL-VLLTKSTRLTMTRNAVWAL 235

  Fly   174 RKLCISSQPSPPD--NAAEIIQALNIVLYNPEANVLEDALMAVRNLAHG-NETIQMLLDFEVVPR 235
            ..||....| |||  ..:..:..|:.:|::.::::|.||..|:..|:.| ||.||.::|..|..|
Zfish   236 SNLCRGKSP-PPDFEKVSPCLPVLSRLLFSSDSDLLADACWALSYLSDGPNEKIQAVIDSGVCRR 299

  Fly   236 IIYLLEHPNVTVQNAALQALINIATGSEEQIQELLNNNLLPHLSALMSNSDPDIRCQVLKLLLNI 300
            ::.||.|.:..|.:.:|:|:.||.||.:.|.|.:||.:.||.|..|:|::...||.:....:.||
Zfish   300 LVELLMHSDYKVASPSLRAVGNIVTGDDIQTQVVLNCSALPCLLHLLSSAKESIRKEACWTISNI 364

  Fly   301 ADGNIFQRHAIMNAGLLHKILECLKADAISLKSAAALTITTLAIDKDKNLLCYLMRQGVIPEFCN 365
            ..||..|..|:::|.:...::|.|:......:..||..||..........:.||:..|.|...|:
Zfish   365 TAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVNLGCIKPLCD 429

  Fly   366 LLFCQERDILSNVLDILSTMLDVDPSFSAEVSG--------IIEWSGALNNIRMLQSSEHEEIAA 422
            ||...:..|:...|:.|..:|.:... .|:.:|        :||.:..|:.|..|||.|::||..
Zfish   430 LLTVMDSKIVLVALNGLENILRLGEQ-EAKQNGSGLNPYCSLIEEAYGLDKIEFLQSHENQEIYQ 493

  Fly   423 VARKIIGNYF 432
            .|..:|.:||
Zfish   494 KAFDLIEHYF 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphaKap4NP_648007.1 ARM 57..177 CDD:237987 36/120 (30%)
armadillo repeat 98..134 CDD:293788 14/35 (40%)
armadillo repeat 140..176 CDD:293788 10/35 (29%)
ARM 189..301 CDD:237987 37/112 (33%)
armadillo repeat 192..217 CDD:293788 6/24 (25%)
armadillo repeat 224..260 CDD:293788 13/35 (37%)
armadillo repeat 266..300 CDD:293788 10/33 (30%)
ARM 276..385 CDD:237987 29/108 (27%)
armadillo repeat 308..342 CDD:293788 8/33 (24%)
armadillo repeat 350..383 CDD:293788 9/32 (28%)
Arm_3 400..>433 CDD:292804 13/32 (41%)
kpna6XP_001923921.1 IBB 9..103 CDD:280005
SRP1 36..536 CDD:227396 122/399 (31%)
ARM 119..240 CDD:237987 37/121 (31%)
armadillo repeat 127..153 CDD:293788 7/25 (28%)
armadillo repeat 161..197 CDD:293788 14/35 (40%)
armadillo repeat 203..238 CDD:293788 10/35 (29%)
ARM 252..366 CDD:237987 38/113 (34%)
armadillo repeat 255..280 CDD:293788 6/24 (25%)
armadillo repeat 288..324 CDD:293788 13/35 (37%)
armadillo repeat 330..364 CDD:293788 10/33 (30%)
ARM 331..449 CDD:237987 33/117 (28%)
armadillo repeat 372..408 CDD:293788 8/35 (23%)
armadillo repeat 415..449 CDD:293788 10/33 (30%)
Arm_3 465..511 CDD:292804 13/38 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5064
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54553
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000157
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.