DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10479 and RIN1

DIOPT Version :10

Sequence 1:NP_001261458.1 Gene:CG10479 / 38674 FlyBaseID:FBgn0035656 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_004283.2 Gene:RIN1 / 9610 HGNCID:18749 Length:783 Species:Homo sapiens


Alignment Length:129 Identity:38/129 - (29%)
Similarity:63/129 - (48%) Gaps:14/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LLACP-WYQPRITAKAALEHLQQATPGSFLLRRSTPRHFE-LVLRLERNNK---VKTYPVQSTRN 304
            ||..| |.|.:..|.|||..|:...||:||:|:|..|..: |.:||...:.   |.::.:..:..
Human    63 LLTRPVWLQLQANAAAALHMLRTEPPGTFLVRKSNTRQCQALCMRLPEASGPSFVSSHYILESPG 127

  Fly   305 QMYRLKGAKKQFTSLKALITHHSVMAEQLPLVLDMPRERHVVKPSSVRYADDFEPLESLQLLGI 368
            .: .|:|::..|..|..||..:....:.|.|.|.:||        ::.:|...:.||::..|||
Human   128 GV-SLEGSELMFPDLVQLICAYCHTRDILLLPLQLPR--------AIHHAATHKELEAISHLGI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10479NP_001261458.1 SH2 249..326 CDD:198173 25/81 (31%)
RIN1NP_004283.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
SH2 58..158 CDD:472789 28/95 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..282
Ras and 14-3-3 protein binding region 294..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..342
VPS9 489..607 CDD:128469
Ubl1_cv_Nsp3_N-like 625..705 CDD:475130
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..783
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.