DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10479 and sh2d5

DIOPT Version :9

Sequence 1:NP_001261458.1 Gene:CG10479 / 38674 FlyBaseID:FBgn0035656 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001349485.1 Gene:sh2d5 / 541529 ZFINID:ZDB-GENE-050327-67 Length:410 Species:Danio rerio


Alignment Length:255 Identity:57/255 - (22%)
Similarity:99/255 - (38%) Gaps:64/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 EEEEEERDADCSCSSTGSSST--------SSSSPTTPKRSPQKSLLSLNCWQSSQPSSD--SNPE 185
            |:..||...:||......:.:        |.|:..:.:|:|.:.||. .....||.|::  |:||
Zfish   150 EKHPEEAQEECSGKKPSRAPSLLNQGFPLSVSALVSFRRAPTQGLLP-GAKLFSQQSTEQVSSPE 213

  Fly   186 EEQDEEAEEDSDAGISDCCQLLAENSPNTMSKRRRAAPLFTRYISANQNSDDDEDEEPELLACPW 250
            |            |.:....::.:.:..|...|..|...|| :....|....|:      |:.|.
Zfish   214 E------------GPTSSPTIVRKMAIRTKELRSGAYRSFT-FTPLKQRHLQDK------LSAPQ 259

  Fly   251 YQPRITAKAAL----------EHLQQA-------------------TPGSFLL--RRSTPRHFEL 284
            .:.:.||||.:          |.|.||                   ..|:|||  ....|....|
Zfish   260 EKEQATAKACMSRAPSLAETEEALAQAVWCWAGVSSDCSSSLLADDVLGAFLLCPHPKKPNRGSL 324

  Fly   285 VLRLERNNKVKTYPVQSTRNQMYRLKGAKKQFTSLKALITHHSVMAEQLPLVLDMPRERH 344
            ::|.  ::.:.||.:::::.: :||:.....|.||.||:.|::...::|...|...|..|
Zfish   325 IVRF--SSGLVTYAIKNSKGK-FRLEKCHTDFESLAALMEHYTEFGDELECSLSCARVNH 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10479NP_001261458.1 SH2 249..326 CDD:198173 25/107 (23%)
sh2d5NP_001349485.1 PTB_tensin-related 25..152 CDD:269979 1/1 (100%)
SH2 288..363 CDD:198173 16/77 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.