DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10479 and SH2D5

DIOPT Version :9

Sequence 1:NP_001261458.1 Gene:CG10479 / 38674 FlyBaseID:FBgn0035656 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001096631.1 Gene:SH2D5 / 400745 HGNCID:28819 Length:423 Species:Homo sapiens


Alignment Length:104 Identity:30/104 - (28%)
Similarity:45/104 - (43%) Gaps:4/104 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 DEEPELLACPWYQPRITAKAALEHLQQATPGSFLLRRSTPRHFELVLRLERNNKVKTYPVQSTRN 304
            :.|..|....|....|:...||..|::...|:|||........:..|.:  ..:....|.|..||
Human   286 ESEGSLTENIWAFAGISRPCALALLRRDVLGAFLLWPELGASGQWCLSV--RTQCGVVPHQVFRN 348

  Fly   305 QM--YRLKGAKKQFTSLKALITHHSVMAEQLPLVLDMPR 341
            .:  |.|:....:|.||:||:.:|:|....|...|||.|
Human   349 HLGRYCLEHLPAEFPSLEALVENHAVTERSLFCPLDMGR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10479NP_001261458.1 SH2 249..326 CDD:198173 21/78 (27%)
SH2D5NP_001096631.1 PTB_tensin-related 23..150 CDD:269979
SH2 296..372 CDD:198173 21/77 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..423
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.