DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and RCCD1

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001017919.1 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens


Alignment Length:185 Identity:56/185 - (30%)
Similarity:81/185 - (43%) Gaps:48/185 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKAKRARIAFHLELPKRRTVL----GNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDI 79
            |.|...| |..|||.....:|    |.|...|.|..||||.|  |..||.:.|..:.|:..| ::
Human   153 PLAPELR-ARQLELGAEHALLLDAAGQVFSWGGGRHGQLGHGTLEAELEPRLLEALQGLVMA-EV 215

  Fly    80 SAGGMHNLVLTKSGDIYSFGCNDEGALGRDT-----------------SEDGSESK--------- 118
            :|||.|::.::::||||.:|.|:.|.|...|                 :||||:.|         
Human   216 AAGGWHSVCVSETGDIYIWGWNESGQLALPTRNLAEDGETVAREATELNEDGSQVKRTGGAEDGA 280

  Fly   119 ----------PDLIDLP--GKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMG 161
                      |.|:|||  ..|:..|.|..|:|.:...|.::.||  ...:|.:|
Human   281 PAPFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWG--WGKYGQLG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 19/48 (40%)
RCC1 92..141 CDD:278826 24/86 (28%)
RCC1_2 131..158 CDD:290274 7/26 (27%)
RCC1 144..193 CDD:278826 5/18 (28%)
RCC1_2 182..209 CDD:290274
RCC1 363..414 CDD:278826
RCCD1NP_001017919.1 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 7/16 (44%)
ATS1 <156..340 CDD:227511 54/182 (30%)
RCC1 2 176..227 19/51 (37%)
RCC1 3 229..317 24/87 (28%)
RCC1 4 318..371 5/18 (28%)
RCC1 319..366 CDD:395335 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.