DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and ATS1

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_009382.2 Gene:ATS1 / 851213 SGDID:S000000018 Length:333 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:72/344 - (20%)
Similarity:121/344 - (35%) Gaps:107/344 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAV--DISAGGMHNLVLTKSGDIYSFGCNDEG 104
            |...|:....|||||  ||:...:|..|  |...|:  .|:.||.|:::||..|::...|.|..|
Yeast     4 VYAFGSNGQRQLGLGHDEDMDTPQRSVP--GDDGAIVRKIACGGNHSVMLTNDGNLVGCGDNRRG 66

  Fly   105 ALGRDTSEDGSES-------KPDLIDLPGKALCISAGDSHSACLLEDGRVFAWG----SFRDSHG 158
            .|      |.:::       :|  :::|...:.::.|...:..:..||||:..|    .|...|.
Yeast    67 EL------DSAQALRQVHDWRP--VEVPAPVVDVACGWDTTVIVDADGRVWQRGGGCYEFTQQHV 123

  Fly   159 NMG---------------LTIDGNK------RTPIDLME---------------GTVCCS-IASG 186
            .:.               :.:.|.:      .|...|.|               |:|... :|.|
Yeast   124 PLNSNDERIAVYGCFQNFVVVQGTRVYGWGSNTKCQLQEPKSRSLKEPVLVYDTGSVAVDYVAMG 188

  Fly   187 ADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWATNY 251
            .|.:||:...|::....       |||.      .|...|:...|...:::       .:|.:.:
Yeast   189 KDFMVIVDEGGRIVHAS-------GRLP------TGFELKQQQKRHNLVVL-------CMWTSIH 233

  Fly   252 CTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTELKD--IRHIAGGQHHTVILTTDLK- 313
                       :|...||..:.....|..:.|     ..|..|  |..:|.|..|.::.|.:.: 
Yeast   234 -----------LWNARLNTVESFGRGTHSQLF-----PQERLDFPIVGVATGSEHGILTTANQEG 282

  Fly   314 ---CSVV---GRPEYGRLG 326
               |..|   |..|:|..|
Yeast   283 KSHCYNVYCWGWGEHGNCG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 17/48 (35%)
RCC1 92..141 CDD:278826 9/55 (16%)
RCC1_2 131..158 CDD:290274 7/30 (23%)
RCC1 144..193 CDD:278826 17/89 (19%)
RCC1_2 182..209 CDD:290274 6/27 (22%)
RCC1 363..414 CDD:278826
ATS1NP_009382.2 ATS1 1..333 CDD:227511 72/344 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.