DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and AT1G27060

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_174026.1 Gene:AT1G27060 / 839595 AraportID:AT1G27060 Length:386 Species:Arabidopsis thaliana


Alignment Length:336 Identity:85/336 - (25%)
Similarity:128/336 - (38%) Gaps:96/336 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GNVLVCGNGDVGQLGLGEDILERKRLSPVAGIP----DAVDISAGGM-HNLVLTKSGDIYSFGCN 101
            |.:..||||..||||.|:.:    .||..|.:.    |:|.:.|.|| |:|||.....:..||..
plant   119 GCIFTCGNGSFGQLGHGDTL----SLSTPAKVSHFNNDSVKMVACGMRHSLVLFAGNQVCGFGSG 179

  Fly   102 DEGALGRDTSEDGSESKPDLI----DLPGKALCISAGDSHSACLLEDGRVFAWG----SFRDSHG 158
            ..|.||..:....|.:.|.::    |:  :.:.|||...|||.:..||:.|:||    ...|.|.
plant   180 KRGQLGFSSDRIKSVNLPCVVSGLKDV--EVVRISANGDHSAAISADGQFFSWGRGFCGGPDVHA 242

  Fly   159 NMGLTIDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGR 223
            ...|.      :|:...|      :|.|.:|.::||..|:||.:|                    
plant   243 PQSLP------SPLSFRE------VAVGWNHALLLTVDGEVFKLG-------------------- 275

  Fly   224 RGKRDLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPI 288
                                        .|..::.:.|           ||..::....|...|.
plant   276 ----------------------------STLNKQPEKQ-----------QLQIDSSEALFEKVPD 301

  Fly   289 KTELKDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVK----KLTEKIVS 349
            ...:| :..||.|..|:..:|.:.:....|..|:|:||||:..|.. .|.:|.    .|..|.:.
plant   302 FDGVK-VMQIAAGAEHSAAVTENGEVKTWGWGEHGQLGLGNTNDQT-SPELVSLGSIDLRTKEIK 364

  Fly   350 VGCGEVCSYAV 360
            |.||...:|||
plant   365 VYCGSGFTYAV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 20/51 (39%)
RCC1 92..141 CDD:278826 14/52 (27%)
RCC1_2 131..158 CDD:290274 12/30 (40%)
RCC1 144..193 CDD:278826 13/52 (25%)
RCC1_2 182..209 CDD:290274 9/26 (35%)
RCC1 363..414 CDD:278826
AT1G27060NP_174026.1 ATS1 17..379 CDD:227511 85/336 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.