DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and AT3G15430

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001325716.1 Gene:AT3G15430 / 820782 AraportID:AT3G15430 Length:488 Species:Arabidopsis thaliana


Alignment Length:361 Identity:90/361 - (24%)
Similarity:122/361 - (33%) Gaps:132/361 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LSPVAGIPDAVDISAG------GMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSES------KP 119
            |..|....|.|:.|.|      |.::.:|..:..:||.|.:..|.|..     |||:      .|
plant    97 LQSVEQSSDMVETSQGKMQIATGKYHTLLINNSKVYSCGVSLSGVLAH-----GSETTQCVAFTP 156

  Fly   120 DLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTIDGNKRTPIDLMEGTVCCSIA 184
            .....|.:...:||..:|||.:|:.|:|...|. ..||                      ||   
plant   157 IEFPFPAQVAQVSATQNHSAFVLQSGQVLTCGD-NSSH----------------------CC--- 195

  Fly   185 SGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAIWAT 249
                                                    |..|..||    |.|.|..||:   
plant   196 ----------------------------------------GHLDTSRP----IFRPKLVEAL--- 213

  Fly   250 NYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTELKDIRHIAGGQHHTVILTTDLKC 314
                                         ||     ||.|       .:|.|.|.||.|:.:...
plant   214 -----------------------------KG-----TPCK-------QVAAGLHFTVFLSREGHA 237

  Fly   315 SVVGRPEYGRLGLGDVKD-VVEKPTIVKKLTEKIVSVGCGEVCSYAVTIDGKLYSWGSGVNNQLG 378
            ...|...:|:||.||..| .|.|.....|....:|.:..|.....|||.||.:||:|||.|..||
plant   238 YTCGSNTHGQLGHGDTLDRPVPKVVEFLKTIGPVVQIAAGPSYVLAVTQDGSVYSFGSGSNFCLG 302

  Fly   379 VGDGDDELEPIVVVSKNTQGKHMLLASGGGQHAIFL 414
            .|:..|||:|.|:.:...:|.|:|..|.|.:||:.|
plant   303 HGEQQDELQPRVIQAFKRKGIHILRVSAGDEHAVAL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 7/27 (26%)
RCC1 92..141 CDD:278826 15/54 (28%)
RCC1_2 131..158 CDD:290274 10/26 (38%)
RCC1 144..193 CDD:278826 7/48 (15%)
RCC1_2 182..209 CDD:290274 0/26 (0%)
RCC1 363..414 CDD:278826 23/50 (46%)
AT3G15430NP_001325716.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.