Sequence 1: | NP_523943.1 | Gene: | Rcc1 / 38669 | FlyBaseID: | FBgn0002638 | Length: | 547 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_078878.3 | Gene: | HECTD3 / 79654 | HGNCID: | 26117 | Length: | 861 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 76/203 - (37%) | Gaps: | 56/203 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 EDIL---------ERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGC-NDEGALGRDT--S 111
Fly 112 EDGSESKPDLIDLPGKALCISAGDSHSACLL-----EDG----RVFAWGSFRDSHGNMG-LTIDG 166
Fly 167 NKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRG---KRD 228
Fly 229 LLRPTQLI 236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rcc1 | NP_523943.1 | RCC1 | 42..89 | CDD:278826 | 7/38 (18%) |
RCC1 | 92..141 | CDD:278826 | 10/51 (20%) | ||
RCC1_2 | 131..158 | CDD:290274 | 8/35 (23%) | ||
RCC1 | 144..193 | CDD:278826 | 12/53 (23%) | ||
RCC1_2 | 182..209 | CDD:290274 | 5/26 (19%) | ||
RCC1 | 363..414 | CDD:278826 | |||
HECTD3 | NP_078878.3 | APC10-HECTD3 | 238..371 | CDD:176487 | 34/163 (21%) |
HECT | 579..845 | CDD:366212 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |