DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and HECTD3

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:203 Identity:45/203 - (22%)
Similarity:76/203 - (37%) Gaps:56/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EDIL---------ERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGC-NDEGALGRDT--S 111
            ||::         |.:.|..|....:::|:|:       .|:.   ::..| .|..|   ||  .
Human   220 EDLIHFLYDHLGKEDENLGSVKQYVESIDVSS-------YTEE---FNVSCLTDSNA---DTYWE 271

  Fly   112 EDGSESKPDLIDLPGKALCISAGDSHSACLL-----EDG----RVFAWGSFRDSHGNMG-LTIDG 166
            .|||:.:..:      .|.:..|......||     :|.    ||..:|...|:...:. ::|| 
Human   272 SDGSQCQHWV------RLTMKKGTIVKKLLLTVDTTDDNFMPKRVVVYGGEGDNLKKLSDVSID- 329

  Fly   167 NKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRG---KRD 228
                  :.:.|.||. :.....||.|:    ::..|.|.:.|...||....|....:|.   ..|
Human   330 ------ETLIGDVCV-LEDMTVHLPII----EIRIVECRDDGIDVRLRGVKIKSSRQRELGLNAD 383

  Fly   229 LLRPTQLI 236
            |.:||.|:
Human   384 LFQPTSLV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 7/38 (18%)
RCC1 92..141 CDD:278826 10/51 (20%)
RCC1_2 131..158 CDD:290274 8/35 (23%)
RCC1 144..193 CDD:278826 12/53 (23%)
RCC1_2 182..209 CDD:290274 5/26 (19%)
RCC1 363..414 CDD:278826
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487 34/163 (21%)
HECT 579..845 CDD:366212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.