DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and RCBTB1

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001339429.1 Gene:RCBTB1 / 55213 HGNCID:18243 Length:531 Species:Homo sapiens


Alignment Length:324 Identity:84/324 - (25%)
Similarity:129/324 - (39%) Gaps:45/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LSP--VAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLID-LPGKA 128
            |||  :|.|..|..........|.:|.:.:::.||.|....||  |.::.|...|..:: |.||.
Human    13 LSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLG--TGDNQSTLVPKKLEGLCGKK 75

  Fly   129 L-CISAGDS-HSACLLEDGRVFAWGSFRDSHGNMGLTIDGNKRTPIDLMEGTVCCS--------I 183
            : .:|.|.. |.....|||.|:||       |:.|.:..||..|...:....||.:        :
Human    76 IKSLSYGSGPHVLLSTEDGVVYAW-------GHNGYSQLGNGTTNQGIAPVQVCTNLLIKQVVEV 133

  Fly   184 ASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEAI-- 246
            |.|:.|.:.|...|:||..|....||:|..|..:             :||...:|.....:.:  
Human   134 ACGSHHSMALAADGEVFAWGYNNCGQVGSGSTAN-------------QPTPRKVTNCLHIKRVVG 185

  Fly   247 WATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTELKD---IRHIAGGQHHTVIL 308
            .|....:.|.......::..|.|...||.....|.:  |||::.....   :..|..|..||:.|
Human   186 IACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQ--LTPVRVAALHSVCVNQIVCGYAHTLAL 248

  Fly   309 TTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLTEKIVSV-GCGEV-CSYAVTIDGKLYSWG 370
            |.:......|...||:||.|: |:.:..|..:....|::|.: .|... .|.|.|..|.:|.||
Human   249 TDEGLLYAWGANTYGQLGTGN-KNNLLSPAHIMVEKERVVEIAACHSAHTSAAKTQGGHVYMWG 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 7/23 (30%)
RCC1 92..141 CDD:278826 14/51 (27%)
RCC1_2 131..158 CDD:290274 9/27 (33%)
RCC1 144..193 CDD:278826 15/56 (27%)
RCC1_2 182..209 CDD:290274 8/34 (24%)
RCC1 363..414 CDD:278826 4/8 (50%)
RCBTB1NP_001339429.1 RCC1 1 40..91 14/52 (27%)
ATS1 43..>316 CDD:227511 76/294 (26%)
RCC1 2 93..145 16/58 (28%)
RCC1 3 147..198 13/63 (21%)
RCC1 4 199..250 13/52 (25%)
RCC1 5 252..302 13/50 (26%)
RCC1 6 304..356 4/8 (50%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.