DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and nek8

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_012812229.1 Gene:nek8 / 448753 XenbaseID:XB-GENE-990378 Length:698 Species:Xenopus tropicalis


Alignment Length:364 Identity:86/364 - (23%)
Similarity:152/364 - (41%) Gaps:77/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 DAVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRDTSEDGSESKPDLID----------LPGKA- 128
            :.|.:|||......:||||.:..:.....|.        |:.|.|..|:          |.|:: 
 Frog   341 EVVQVSAGRTQKAGVTKSGRLIMWEATPVGT--------GAPSLPGSIEHAQPQFISRFLEGQSG 397

  Fly   129 ---LCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTIDGNKRTP--IDLMEGTVCCSIASGAD 188
               ..:|.||..:|||.:.|.:..:||  .|:|.:|.....:...|  ::.:.|.....::.||.
 Frog   398 VTIKHVSCGDLFTACLTDRGIIMTFGS--GSNGCLGHANFNDVTQPKIVEDLLGYEIVHVSCGAS 460

  Fly   189 HLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRDLLRPTQLIITRAKPFEA------IW 247
            |.:.::...:||:.|..:.|:||..|:.|.:.           |.|:||  ...:||      |.
 Frog   461 HAIAVSNEKEVFSWGRGDNGRLGLGSQESYNS-----------PQQVII--PPEYEAQRVVCGID 512

  Fly   248 ATNYCTFMRESQTQVIWATGLNNFKQL-------AHETKGKE-----FALTPIKTE--------L 292
            ::...|...:     :.|.|.|.|.:|       |.|...::     :..|||::.        .
 Frog   513 SSMILTVANQ-----LLACGSNRFNKLGFDRILSASEPSSEDQVEEAYTFTPIQSAPLNQEAILC 572

  Fly   293 KDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKDVVEKPTIVKKLT-EKIVSVGCGEVC 356
            .|:     |..|:.::|...:|...|..::|:||....:: ...|.:|..|. .|:..|.||:..
 Frog   573 ADV-----GTSHSAVVTALGQCYTFGSNQHGQLGTSAHRN-SRVPCLVSALQGVKVTMVACGDAY 631

  Fly   357 SYAVTIDGKLYSWGSGVNNQLGVGDGDDELEPIVVVSKN 395
            :.||..:|::::||.|...:||..|....:..||.:.:|
 Frog   632 TVAVGAEGQVFTWGKGARGRLGRRDEGIGIPKIVQLEEN 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 4/13 (31%)
RCC1 92..141 CDD:278826 13/62 (21%)
RCC1_2 131..158 CDD:290274 10/26 (38%)
RCC1 144..193 CDD:278826 11/50 (22%)
RCC1_2 182..209 CDD:290274 6/26 (23%)
RCC1 363..414 CDD:278826 10/33 (30%)
nek8XP_012812229.1 STKc_Nek8 3..258 CDD:270859
S_TKc 4..256 CDD:214567
ATS1 320..657 CDD:227511 82/349 (23%)
RCC1 421..465 CDD:278826 10/45 (22%)
RCC1 470..517 CDD:278826 15/59 (25%)
RCC1 587..635 CDD:278826 12/48 (25%)
RCC1 638..687 CDD:278826 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.