DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and CG6678

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster


Alignment Length:180 Identity:53/180 - (29%)
Similarity:77/180 - (42%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GNVLVCGNGDVGQLGLGEDILER--KRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEG 104
            |:|...|||..|||||.|..:|.  :.|..:||| ....|:|||.|:..::..||:|::|.|..|
  Fly   193 GDVFTWGNGLRGQLGLAELRVEETPQLLEALAGI-KITQIAAGGWHSAAISAFGDLYTWGLNCSG 256

  Fly   105 ALGRDTSEDGSESK-------PDLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGL 162
            .||....:.|...|       |.|.||| :..|..:|:|:..|  ...||||             
  Fly   257 QLGLRVMKPGGVLKEPTVFPLPQLQDLP-ECACSQSGESNDDC--APLRVFA------------- 305

  Fly   163 TIDGNKRTPIDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGR 212
                                   |:.|.:::...|:::..|..:.|||||
  Fly   306 -----------------------GSRHTLLIRRCGRLWVSGWCKHGQLGR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 21/48 (44%)
RCC1 92..141 CDD:278826 18/55 (33%)
RCC1_2 131..158 CDD:290274 7/26 (27%)
RCC1 144..193 CDD:278826 6/48 (13%)
RCC1_2 182..209 CDD:290274 4/26 (15%)
RCC1 363..414 CDD:278826
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 53/180 (29%)
RCC1_2 176..205 CDD:290274 5/11 (45%)
RCC1 192..241 CDD:278826 21/48 (44%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442600
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.