DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and Sergef

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_038956885.1 Gene:Sergef / 365243 RGDID:1563497 Length:481 Species:Rattus norvegicus


Alignment Length:310 Identity:81/310 - (26%)
Similarity:123/310 - (39%) Gaps:77/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCNDEG 104
            |.:.|||....||||||  |::|......|:.|.| ...::.|....::||:.|.:.|.|.|..|
  Rat    68 GGLFVCGLNKDGQLGLGHTEEVLRFTICKPLLGCP-IRQVACGWDFTIMLTEKGQVLSCGSNAFG 131

  Fly   105 ALGRDTSEDGSES--KPDLID-LPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHG-------N 159
            .||   ...|...  .|..|: |..|.:|::||..|:....:.|..|.||:...|.|       |
  Rat   132 QLG---VPHGPRKCVVPQAIECLREKVVCVAAGLRHALATTDTGSTFQWGTGLASSGRRLCPGQN 193

  Fly   160 MGLTIDGNKRTPIDLME-GTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGR 223
            :.|.:...:.:.:..:| .||.|::| |:||...||..|:::..|..:.|||..|:         
  Rat   194 LPLFLTAKEPSRVTGLESSTVVCAVA-GSDHSASLTDTGELYVWGRNKHGQLASLA--------- 248

  Fly   224 RGKRDLLRPTQLIITRAKPFE-----AIWATNYCTFMRESQTQVIWATGLNNFKQ-------LAH 276
                ..|...|.:  .|..|:     |:|:         ..|.::..||  ||:.       ...
  Rat   249 ----TFLPLPQRV--EAHYFQDEKVTAVWS---------GWTHLVAKTG--NFRAPWTGMLCFFS 296

  Fly   277 ETKGKEFALTPIKTELKDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLG 326
            ..:|...|||..:|.                     |....||.:||:||
  Rat   297 VNRGPRGALTTSETG---------------------KVFTWGRADYGQLG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 16/48 (33%)
RCC1 92..141 CDD:278826 16/51 (31%)
RCC1_2 131..158 CDD:290274 8/26 (31%)
RCC1 144..193 CDD:278826 16/56 (29%)
RCC1_2 182..209 CDD:290274 8/26 (31%)
RCC1 363..414 CDD:278826
SergefXP_038956885.1 ATS1 17..>325 CDD:227511 79/308 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337067
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.