DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and Rcbtb1

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001101850.1 Gene:Rcbtb1 / 361050 RGDID:1308467 Length:531 Species:Rattus norvegicus


Alignment Length:337 Identity:79/337 - (23%)
Similarity:137/337 - (40%) Gaps:64/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GNVLVCGNGDVGQLGLGEDILERKRLSPVAG-----IPDAVDISAGGMHNLVLTKSGDIYSFGCN 101
            |.|...|:....|||.|   ...:.::|:..     :...|:::.|..|::.|...|:::::|.|
  Rat    94 GVVYAWGHNGYSQLGNG---TTNQGIAPIQVCTNLLVKQVVEVACGSHHSMALAADGELFAWGYN 155

  Fly   102 DEGALGR-DTSEDGSESKPDLIDLPGKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTID 165
            :.|.:|. .|:...:..|........|.:.|:.|.:.|..:|:.|.|:.||  .:.:|.:||..:
  Rat   156 NCGQVGSGSTANQPTPRKVTNCLHTKKVVNIACGQTSSMAVLDSGEVYGWG--YNGNGQLGLGNN 218

  Fly   166 GNKRTPIDL--MEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKRD 228
            ||:.||:.:  :.|.....|..|..|.:.||..|.::..|....||||..|           |.:
  Rat   219 GNQLTPVRVAALHGVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGS-----------KNN 272

  Fly   229 LLRPTQLIITRAKPFEAIWATNYCTFMRESQTQ----VIWATGLNNFKQLAHETKGKEFALTPIK 289
            ||.|||:::.:.:..|.  |..:.|....::||    .:|.           :.:|:...|    
  Rat   273 LLSPTQIMVEKERVIEI--AACHSTHTSAAKTQGGHVYMWG-----------QCRGQSVIL---- 320

  Fly   290 TELKDIRHIAGGQHHTVILTTDLKCSVVGRPEYG-RLGLGDVKDVVEKPTIVKKLTEKIVSVGCG 353
                        .|.|....||...:..|.|... ||...:.:|.:   |:.:.|.::..|   .
  Rat   321 ------------PHLTHFSCTDDVFACFGTPAVSWRLLSVEHEDFL---TVAESLKKEFDS---P 367

  Fly   354 EVCSYAVTIDGK 365
            |.......||||
  Rat   368 ETADLKFRIDGK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 11/51 (22%)
RCC1 92..141 CDD:278826 11/49 (22%)
RCC1_2 131..158 CDD:290274 8/26 (31%)
RCC1 144..193 CDD:278826 15/50 (30%)
RCC1_2 182..209 CDD:290274 7/26 (27%)
RCC1 363..414 CDD:278826 3/3 (100%)
Rcbtb1NP_001101850.1 RCC1 42..89 CDD:395335
ATS1 <91..363 CDD:227511 73/316 (23%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662 9/36 (25%)
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.