DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and Rcbtb2

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_038949091.1 Gene:Rcbtb2 / 290363 RGDID:735048 Length:585 Species:Rattus norvegicus


Alignment Length:341 Identity:82/341 - (24%)
Similarity:131/341 - (38%) Gaps:76/341 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 TVLGNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGCN 101
            ||...:.|.|....|.||:|  :..:|.:||..:.|...|......|.|.::.|..|:::::|.|
  Rat    96 TVNDEIFVLGTNCSGCLGVGDIQSTIEPRRLDSLTGKKIASLSYGSGPHIVLATTDGEVFTWGHN 160

  Fly   102 DEGALGRDTSEDGSESKPDLIDLPGKALC-ISAGDSHSACLLEDGRVFAWGSFRDSHGNMGLTID 165
            ....||..|:..|........:|..|.:. ::.|..||..|..||.|||||  .::.|.:|....
  Rat   161 AYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWG--YNNSGQVGSGST 223

  Fly   166 GNKRTP---IDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERSISGEGRRGKR 227
            .|:..|   ...::..|..|||.|....:.:...|:|:..|....||||.         |..|. 
  Rat   224 ANQPIPRRVTGCLQNKVVMSIACGQMCSMAVVDTGEVYVWGYNGNGQLGL---------GSSGN- 278

  Fly   228 DLLRPTQLIITRAKPFEAIWATNYCTFMRESQTQVIWATGLNNFKQLAHETKGKEFALTPIKTEL 292
               :||...:.                                             ||..|:   
  Rat   279 ---QPTPCRVA---------------------------------------------ALQGIR--- 292

  Fly   293 KDIRHIAGGQHHTVILTTDLKCSVVGRPEYGRLGLGDVKD-VVEKPTIVKKLTEKIVSV-GCGEV 355
              ::.:|.|..||::||.:.:....|...||:||.|:..: ....|.:|:|  ::|:.: .|...
  Rat   293 --VQRVACGYAHTLVLTDEGQIYAWGANSYGQLGTGNKSNQSYPTPVVVEK--DRIIEIAACHSA 353

  Fly   356 -CSYAVTIDGKLYSWG 370
             .|.|.:..|.:|.||
  Rat   354 HTSAAKSQGGHVYMWG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 13/48 (27%)
RCC1 92..141 CDD:278826 12/49 (24%)
RCC1_2 131..158 CDD:290274 11/26 (42%)
RCC1 144..193 CDD:278826 16/51 (31%)
RCC1_2 182..209 CDD:290274 7/26 (27%)
RCC1 363..414 CDD:278826 4/8 (50%)
Rcbtb2XP_038949091.1 ATS1 <141..421 CDD:227511 69/296 (23%)
BTB_POZ_RCBTB2_CHC1L 408..524 CDD:349663
BACK_RCBTB2 521..585 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.