DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and Rccd1

DIOPT Version :10

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_775621.2 Gene:Rccd1 / 269955 MGIID:2444156 Length:377 Species:Mus musculus


Alignment Length:183 Identity:54/183 - (29%)
Similarity:79/183 - (43%) Gaps:46/183 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PKAKRARIAFHLELPKRRTVL----GNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDI 79
            |.|...|:. .|||.....:|    |.|...|.|..||||.|  |..||.:.|..:.|:..| .:
Mouse   156 PLAPELRVR-QLELGAEHVLLLCAAGQVFSWGAGRHGQLGHGTLEAELEPRLLEALQGLRMA-KV 218

  Fly    80 SAGGMHNLVLTKSGDIYSFGCNDEGALGRDT----------------SEDGSESK---------- 118
            :|||.|::.|:::||||.:|.|:.|.|...|                :|||.:.:          
Mouse   219 AAGGWHSVCLSETGDIYIWGWNESGQLALPTRSGTENKAEREEATELNEDGLKEELAVADAGAPA 283

  Fly   119 --------PDLIDLP--GKALCISAGDSHSACLLEDGRVFAWGSFRDSHGNMG 161
                    |.|:|||  ..|:..|.|..|:|.:...|.::.||  ...:|.:|
Mouse   284 HFIAIQPFPALLDLPLGSDAVMASCGSRHTAVVTRTGELYTWG--WGKYGQLG 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 ATS1 42..389 CDD:444065 47/158 (30%)
Borrelia_P83 <419..>508 CDD:114011
Rccd1NP_775621.2 Interaction with KDM8. /evidence=ECO:0000250|UniProtKB:A6NED2 1..172 6/16 (38%)
ATS1 <163..344 CDD:444065 51/176 (29%)
RCC1 2 179..230 20/51 (39%)
RCC1 3 232..289 12/56 (21%)
RCC1 4 319..372 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.