DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and ZZEF1

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_016879871.1 Gene:ZZEF1 / 23140 HGNCID:29027 Length:2966 Species:Homo sapiens


Alignment Length:178 Identity:45/178 - (25%)
Similarity:72/178 - (40%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 DGDDELEPIVVVSKNT--------QGKHMLLA-SGGGQHAIFLV----KADKQDQKENVPVKVSG 432
            || ::|:|....|..|        .|..::.| .|.|..|:.|:    ..|...:.:.:||.|..
Human  1921 DG-EKLDPQTRSSATTLRSQCMQLVGDCLMKAHQGKGLKALALLGVLPDGDSSLEDQALPVTVPT 1984

  Fly   433 SSSISKKDKTPPQDNVDKEAENVDKQEQKENLPAKASTSSKKNKTPPQDNADKE---AENVDKQE 494
            .:|..:.:|...|.....||.|..:...:|..|.   ...::||      |||.   :::...|.
Human  1985 GASEEQLEKKAVQGAELSEAGNGKRAVHEEIRPV---DFKQRNK------ADKGVSLSKDPSCQT 2040

  Fly   495 QKENLPAKASTSSKKIKTPPQDDAAEEVEEESAQEPTPKKAKKPAAKR 542
            |..:.||.||        ||......|..|.|:|:|..:||..|:.::
Human  2041 QISDSPADAS--------PPTGLPDAEDSEVSSQKPIEEKAVTPSPEQ 2080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826
RCC1 92..141 CDD:278826
RCC1_2 131..158 CDD:290274
RCC1 144..193 CDD:278826
RCC1_2 182..209 CDD:290274
RCC1 363..414 CDD:278826 11/41 (27%)
ZZEF1XP_016879871.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.