DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and K11D2.1

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:NP_001368497.1 Gene:K11D2.1 / 187290 WormBaseID:WBGene00010768 Length:278 Species:Caenorhabditis elegans


Alignment Length:88 Identity:31/88 - (35%)
Similarity:46/88 - (52%) Gaps:5/88 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RTVLGNVLVCGNGDVGQLGLG--EDILERKRLSPVAGIPDAVDISAGGMHNLVLTKSGDIYSFGC 100
            |...||:...|.|..|:||:|  ..:.|...:..:.|| ....::.||.|.:.||:.||.|::|.
 Worm   146 RDTTGNLFSMGTGTRGELGVGLIRRVDEPVHIEQLVGI-RIKKVACGGWHTVALTEGGDAYTWGW 209

  Fly   101 NDEGALGRDTSEDGSESKPDLID 123
            |..|.||:|  :..:|..|.|||
 Worm   210 NRYGQLGKD--KGSTEVYPVLID 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 14/48 (29%)
RCC1 92..141 CDD:278826 14/32 (44%)
RCC1_2 131..158 CDD:290274
RCC1 144..193 CDD:278826
RCC1_2 182..209 CDD:290274
RCC1 363..414 CDD:278826
K11D2.1NP_001368497.1 ATS1 <118..>259 CDD:227511 31/88 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.