DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and LOC100536575

DIOPT Version :9

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_009295984.1 Gene:LOC100536575 / 100536575 -ID:- Length:409 Species:Danio rerio


Alignment Length:177 Identity:51/177 - (28%)
Similarity:79/177 - (44%) Gaps:39/177 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 AVDISAGGMHNLVLTKSGDIYSFGCNDEGALGRD--TSEDGSESKPDLIDLPGKALCISAGDSHS 138
            ||.:..|..|.|:||..|.:||:|....|.||..  ||.:..::...|..:|.||  ::||:.||
Zfish   188 AVSLVLGSEHALLLTADGTLYSWGSGSHGQLGHGVLTSLEDPQAVEALWGVPIKA--VAAGNWHS 250

  Fly   139 ACLLEDGRVFAWGSFRDSHGNMGL----------------------TIDGNKRTP---------- 171
            |.:...|.::.|| :.:| |.:||                      ..||..||.          
Zfish   251 AAVSSGGDLYMWG-WNES-GQLGLPSRGLEEEKRRGNGSGNDDQPINTDGKSRTDVFISIQAFPA 313

  Fly   172 -IDLMEGTVCCSIASGADHLVILTTAGKVFTVGCAEQGQLGRLSERS 217
             :|:...:....|:.|:.|...:|:||.::|.|..:.||||..:|.|
Zfish   314 LVDIANMSEISRISCGSRHTAAVTSAGDLYTWGWGQYGQLGHGTEHS 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 RCC1 42..89 CDD:278826 5/12 (42%)
RCC1 92..141 CDD:278826 18/50 (36%)
RCC1_2 131..158 CDD:290274 9/26 (35%)
RCC1 144..193 CDD:278826 15/81 (19%)
RCC1_2 182..209 CDD:290274 8/26 (31%)
RCC1 363..414 CDD:278826
LOC100536575XP_009295984.1 RCC1_2 189..217 CDD:290274 10/27 (37%)
RCC1 204..253 CDD:278826 18/50 (36%)
RCC1_2 240..269 CDD:290274 11/32 (34%)
RCC1 257..336 CDD:278826 15/80 (19%)
RCC1_2 323..352 CDD:290274 8/28 (29%)
RCC1 340..389 CDD:278826 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.