DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rcc1 and herc1

DIOPT Version :10

Sequence 1:NP_523943.1 Gene:Rcc1 / 38669 FlyBaseID:FBgn0002638 Length:547 Species:Drosophila melanogaster
Sequence 2:XP_017947876.1 Gene:herc1 / 100493988 XenbaseID:XB-GENE-1002062 Length:4854 Species:Xenopus tropicalis


Alignment Length:204 Identity:43/204 - (21%)
Similarity:65/204 - (31%) Gaps:51/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 EELDKVIERLRVPSEYAASLTGGSFDEADMLQNIEAC-EWLAKALRGLEVPNLDPIYANMRAVKE 373
            :|.:||..|......:....||....:..:.....|| .:|||..|         |::.     |
 Frog   513 DECEKVFSRKSSLETHKIGHTGEKPYKCKVCDKAFACHSYLAKHTR---------IHSG-----E 563

  Fly   374 KRAELEKLKATFVRRASEFLRDYFASLVDFKFSDKSY--------FSQRGQL---KRPDHADLRY 427
            |..:..:...||..|:      |..........:|.|        ||:|..|   :|....:..|
 Frog   564 KPYKCNECSKTFSHRS------YLVCHHRVHSGEKPYKCNECSKTFSRRSSLHCHRRLHSGEKPY 622

  Fly   428 KCRTYARLMQHLKGL-NKNCLGPLRKAYCSSL-------NLLLRREAR-----------EFAKEL 473
            ||.......:|...| ....|....|:|..::       |.||.|..|           |..|..
 Frog   623 KCNECGNTFRHCSSLIYHRRLHTGEKSYKCTICDKAFVRNSLLSRHTRIHTAEKPYKCNECGKAF 687

  Fly   474 RASTKVSRN 482
            ...:.:||:
 Frog   688 NQQSHLSRH 696

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rcc1NP_523943.1 ATS1 42..389 CDD:444065 17/79 (22%)
Borrelia_P83 <419..>508 CDD:114011 18/83 (22%)
herc1XP_017947876.1 ATS1 374..703 CDD:444065 43/204 (21%)
RCC1 683..733 CDD:395335 3/14 (21%)
SPRY_HERC1 2025..2182 CDD:293939
UBA_HERC1 2741..2779 CDD:270584
WD40 3359..3793 CDD:441893
WD40 repeat 3432..3466 CDD:293791
WD40 repeat 3471..3513 CDD:293791
WD40 repeat 3520..3565 CDD:293791
WD40 repeat 3576..3612 CDD:293791
WD40 repeat 3620..3646 CDD:293791
WD40 repeat 3663..3694 CDD:293791
WD40 repeat 3743..3769 CDD:293791
WD40 repeat 3785..3819 CDD:293791
ATS1 4023..4353 CDD:444065
HECTc 4466..4834 CDD:238033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.