DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and SEC14

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:66/283 - (23%)
Similarity:114/283 - (40%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQIEELRDRFNRKYASSPPAAPFHPTDIDRI-------------------RNDHLWLQRFLEMYD 56
            ||.:|..:.:.:.  ..|.|.|..|.::|..                   |.|...|.|||....
Yeast     4 QQEKEFLESYPQN--CPPDALPGTPGNLDSAQEKALAELRKLLEDAGFIERLDDSTLLRFLRARK 66

  Fly    57 LDMETSFNSLWETC-ILRQSTGANDI------DESELNQEYLKEGSVFVHNTDVDGKPLL---VF 111
            .|::.: ..::|.| ..|:..|.:.|      ||..|..::..:   :.|.||.||:|:.   :.
Yeast    67 FDVQLA-KEMFENCEKWRKDYGTDTILQDFHYDEKPLIAKFYPQ---YYHKTDKDGRPVYFEELG 127

  Fly   112 RVKMH------SKSKNLDELI----RIVVYWVERTQREQ-HL--TQLTIFFDMSGTSLAS--MDL 161
            .|.:|      |:.:.|..|:    .:|.|.:....|.. ||  |..|| .|:.|.|::|  ..:
Yeast   128 AVNLHEMNKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTI-MDLKGISISSAYSVM 191

  Fly   162 EFVKRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVE---ILKMISKKDINQYIN 223
            .:|:......:.:||..:....:....:..:.||::.|..|.|..|.   ||....:|::.:.|.
Yeast   192 SYVREASYISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIP 256

  Fly   224 KDNCLAIWGGEDNYEFSFVPEAK 246
            .:|....:||:     |.|.|:|
Yeast   257 AENLPVKFGGK-----SEVDESK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 38/160 (24%)
Motile_Sperm 293..396 CDD:279029
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 8/45 (18%)
SEC14 99..269 CDD:214706 41/178 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.