DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CSR1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_013484.3 Gene:CSR1 / 851096 SGDID:S000004372 Length:408 Species:Saccharomyces cerevisiae


Alignment Length:215 Identity:51/215 - (23%)
Similarity:92/215 - (42%) Gaps:64/215 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 VHNTDVDGKPLLVFRVKMHSKSKNLD-ELIRIVVYWVERTQ---REQHLTQLTIFFDMSGTSLAS 158
            :...|.|.:|:::.|.::|..|...: ||.:..:..:|:::   :|.:....||.||::|.|:::
Yeast   171 IQGYDNDMRPVILVRPRLHHSSDQTEQELEKFSLLVIEQSKLFFKENYPASTTILFDLNGFSMSN 235

  Fly   159 MDLEFVKRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILKMISKKDIN---- 219
            ||...||.::..|:..||.||.::|:::..|:.|..:.:||..|.|  |...|::..|:|:    
Yeast   236 MDYAPVKFLITCFEAHYPESLGHLLIHKAPWIFNPIWNIIKNWLDP--VVASKIVFTKNIDELHK 298

  Fly   220 ----QYINKDNCLAIWGGEDNYEFSFVPEAKKVISKPVAANAGDDDQFADKKVTFVDSAPMVLKE 280
                |||.:     ..|||                     |..|.|.:                 
Yeast   299 FIQPQYIPR-----YLGGE---------------------NDNDLDHY----------------- 320

  Fly   281 TNINKMHTPSEGMLHINPKD 300
                   ||.:|.|.::.||
Yeast   321 -------TPPDGSLDVHLKD 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 40/147 (27%)
Motile_Sperm 293..396 CDD:279029 3/8 (38%)
CSR1NP_013484.3 CRAL_TRIO_N 82..130 CDD:397711
CRAL_TRIO 168..312 CDD:395525 40/147 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3654
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.