DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and AT1G75370

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001154472.1 Gene:AT1G75370 / 843873 AraportID:AT1G75370 Length:668 Species:Arabidopsis thaliana


Alignment Length:434 Identity:85/434 - (19%)
Similarity:157/434 - (36%) Gaps:98/434 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IEELR--DRFNRKYASS---PPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCI- 71
            :||||  |.|.....|.   ||..           :|:..:.|||:....|:..: ..:|...| 
plant    85 VEELRAVDEFRNLLVSENLLPPTL-----------DDYHIMLRFLKARKFDIGKT-KLMWSNMIK 137

  Fly    72 LRQSTGANDIDES---ELNQEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSK-----NLDELIRI 128
            .|:..|.:.|.|.   |...|.||......|..|.:|:|:.:.|:.:...:|     .::..||.
plant   138 WRKDFGTDTIFEDFEFEEFDEVLKYYPHGYHGVDKEGRPVYIERLGLVDPAKLMQVTTVERFIRY 202

  Fly   129 VVYWVERT----------QREQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFK---QFYPNSLN 180
            .|...|:|          ..::|:...|...|:.|....:........|::..|   ..||.:|:
plant   203 HVREFEKTVNIKLPACCIAAKRHIDSSTTILDVQGVGFKNFSKPARDLIIQLQKIDNDNYPETLH 267

  Fly   181 YILVYELGWVLNAAFKVIKAVLPPKAVEILKMISKKDINQYI-------------------NKDN 226
            .:.:...|......:..:|..|.||.|..:.:|..|..|:.:                   ::..
plant   268 RMFIINGGSGFKLVWATVKQFLDPKTVTKIHVIGNKYQNKLLEIIDASQLPDFLGGTCTCADRGG 332

  Fly   227 CLAIWGGEDNYEFSFVPEAKKVISK--PVAANAGDDDQFADKKVTFVDSAPMV-LKETNINKMHT 288
            |:....|..|     .||..|::..  |:..:....:.|:  :|:..|..... :|.::.:...:
plant   333 CMRSDKGPWN-----DPEILKMLQSGGPLCRHNSALNSFS--RVSSCDKPSFSGIKASDTSTAES 390

  Fly   289 PSEGMLHINPKDFVNFNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATIN 353
            .||.....:||  ||...:..:.|...:.|..:|::|...::..:           .|..:..::
plant   391 GSEVEEMASPK--VNRELRVPKLTPVCEDIRGTAISYPTDSSEYD-----------SPMVDKVVD 442

  Fly   354 I-WLKSE----HKLSDDSKDKFLVMAMVAPGGECGGADVTELWR 392
            : |:..|    .|.|:|:.|...:..            ||.:||
plant   443 VAWMAHEKPKASKGSEDTPDSGKIRT------------VTYIWR 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 30/176 (17%)
Motile_Sperm 293..396 CDD:279029 19/105 (18%)
AT1G75370NP_001154472.1 CRAL_TRIO_N 89..135 CDD:215024 12/57 (21%)
SEC14 159..324 CDD:238099 31/164 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.