DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and AT1G72160

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_177361.1 Gene:AT1G72160 / 843547 AraportID:AT1G72160 Length:490 Species:Arabidopsis thaliana


Alignment Length:355 Identity:74/355 - (20%)
Similarity:126/355 - (35%) Gaps:105/355 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IEELRDRFNRKYASSPP-----AAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCIL 72
            :.|..|  |.::.::|.     ..|....|    |:| :.|.:||...:..::.||..|..|...
plant   134 VREALD--NHQFTNTPEEVKIWGIPLLEDD----RSD-VVLLKFLRAREFKVKDSFAMLKNTIKW 191

  Fly    73 RQSTGANDIDESELNQEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSKNL------DE-----LI 126
            |:....:::.|.:|..:..|  .||:|..|.:|.| :.:.|....::|.|      ||     .:
plant   192 RKEFKIDELVEEDLVDDLDK--VVFMHGHDREGHP-VCYNVYGEFQNKELYNKTFSDEEKRKHFL 253

  Fly   127 RIVVYWVERTQREQHLTQ---LTIF--FDMSGT-SLASMDL-EFVKRIVETFKQFYPNSLNYILV 184
            |..:.::||:.|:...:.   .|||  .||..: .|...:| ...|:.||..:..||..:.....
plant   254 RTRIQFLERSIRKLDFSSGGVSTIFQVNDMKNSPGLGKKELRSATKQAVELLQDNYPEFVFKQAF 318

  Fly   185 YELGWVLNAAFKVIKAVLPPK-------------AVEILKMISKKDIN-QY-------------- 221
            ..:.|.....:.||...:.|:             |..:.|.||.:.:. ||              
plant   319 INVPWWYLVFYTVIGPFMTPRSKSKLVFAGPSRSAETLFKYISPEQVPVQYGGLSVDPCDCNPDF 383

  Fly   222 ---------------------INKDNCLAIW-----GGEDNYEFSFVPEAKK----VISKPVAAN 256
                                 |..:.|..:|     |.|.:|:..||||.|.    ||.||....
plant   384 SLEDSASEITVKPGTKQTVEIIIYEKCELVWEIRVTGWEVSYKAEFVPEEKDAYTVVIQKPRKMR 448

  Fly   257 AGDDDQFADKKVTFVDSAPMVLKETNINKM 286
            ..|:              |::.....:|::
plant   449 PSDE--------------PVLTHSFKVNEL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 41/211 (19%)
Motile_Sperm 293..396 CDD:279029
AT1G72160NP_177361.1 PRK11907 2..>97 CDD:237019
CRAL_TRIO_N 127..187 CDD:397711 14/59 (24%)
SEC14 203..372 CDD:238099 39/171 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.