DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and AT1G51270

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001154418.1 Gene:AT1G51270 / 841550 AraportID:AT1G51270 Length:637 Species:Arabidopsis thaliana


Alignment Length:249 Identity:60/249 - (24%)
Similarity:94/249 - (37%) Gaps:47/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 SKPVAANAGDDDQFADKKVTFVDSAPMVLKETNINKMHTPSEGMLHINPKDFVNFN---SKNAEA 311
            |..|:......:.|....|..||...|             |:.:|.|:|.| |.|.   :|....
plant   146 SASVSDKGNASEVFVGPSVGIVDLIRM-------------SDELLIIDPVD-VQFPIELNKKVSC 196

  Fly   312 TMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIWLKSEHKLSDD--SKDKFLVMA 374
            ::.:.:...:.|.:|.:||:.:|:.|||..|::.|.....:.:.:::..:...|  .:||.|...
plant   197 SLNLTNKTENYVAFKAKTTNAKKYYVRPNVGVVLPRSSCEVLVIMQALKEAPADMQCRDKLLFQC 261

  Fly   375 -MVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRF---DENKSKAQLDCASKSS-KASVDCSK 434
             :|.|  |....|||....||. .....|:.||...:   .:..|..|......|| :|||.   
plant   262 KVVEP--ETTAKDVTSEMFSKE-AGHPAEETRLKVMYVTPPQPPSPVQEGTEEGSSPRASVS--- 320

  Fly   435 KSGAGVDPATAMERQLAFTQNLQYVTLALLFLLFAGFGFLMYQQLGQHAATCPK 488
                  |...|.|   ||...|:    :||..||:...    .....|..|.|:
plant   321 ------DNGNASE---AFVDMLR----SLLVPLFSNAA----SSTDDHGITLPQ 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 29/108 (27%)
AT1G51270NP_001154418.1 Motile_Sperm 6..113 CDD:279029
Motile_Sperm 176..283 CDD:279029 29/110 (26%)
TIR 357..492 CDD:214587 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.