DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and AT1G19650

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_564092.1 Gene:AT1G19650 / 838552 AraportID:AT1G19650 Length:608 Species:Arabidopsis thaliana


Alignment Length:253 Identity:54/253 - (21%)
Similarity:99/253 - (39%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKETTPQQIEELRD----RFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNS 65
            :..|.....|::.|    |:..::..|..:....|.::|    |:..:.|||.....|:..: ..
plant    62 IDRTLSLTFEDIHDAEELRYVSEFRQSLISDHLLPPNLD----DYHIMLRFLFARKFDLGKA-KL 121

  Fly    66 LWETCI-LRQSTGAN----DIDESELNQ--EYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSK--- 120
            :|...| .|:..|.:    |.:..||::  .|..:|   .|..|.:|:|:.:.|:.....||   
plant   122 MWTNMIQWRRDFGTDTILEDFEFPELDEVLRYYPQG---YHGVDKEGRPVYIERLGKVDASKLMQ 183

  Fly   121 --NLDELIRIVVYWVERT----------QREQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQ 173
              .|:..:|..|...|:|          ..::|:...|...|:.|..|.:    |.|...:...|
plant   184 VTTLERYLRYHVKEFEKTITVKFPACCIAAKRHIDSSTTILDVQGLGLKN----FTKTARDLIIQ 244

  Fly   174 F-------YPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILKMISKKDINQYINK 224
            .       ||.:|:.:.:...|......:..:|:.|.||.|..:.::.    |:|.||
plant   245 LQKIDSDNYPETLHRMFIINAGSGFKLLWGTVKSFLDPKTVSKIHVLG----NKYQNK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 34/153 (22%)
Motile_Sperm 293..396 CDD:279029
AT1G19650NP_564092.1 CRAL_TRIO_N 82..126 CDD:215024 9/48 (19%)
SEC14 146..316 CDD:214706 37/164 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.